BLASTX nr result
ID: Anemarrhena21_contig00017499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00017499 (305 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010916791.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_008784484.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 >ref|XP_010916791.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46460, mitochondrial [Elaeis guineensis] Length = 711 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/56 (53%), Positives = 42/56 (75%) Frame = -3 Query: 177 PVAGPSKNSEGGISYWKSILSNLIRNHEIEQAHQIFSKIPSLDPHLCTMMINGYSQ 10 P A +S+ G S+WK+ILS+L+RN+EI++A +FSKI S D HL TMMI GY++ Sbjct: 36 PSAASKSDSKEGSSHWKAILSHLLRNNEIDEARHVFSKISSPDAHLYTMMITGYAR 91 >ref|XP_008784484.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46460, mitochondrial [Phoenix dactylifera] Length = 711 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = -3 Query: 192 KTFNNPVAGPSKNSEGGISYWKSILSNLIRNHEIEQAHQIFSKIPSLDPHLCTMMINGYS 13 KTF P A ++ + G S+WK+ILS+L+ N++I+ A +FS+I S D HL TMMI GY+ Sbjct: 32 KTFP-PSAASKRDFKEGSSHWKAILSHLLGNNDIDGARHVFSRISSPDVHLYTMMITGYA 90 Query: 12 Q 10 + Sbjct: 91 R 91