BLASTX nr result
ID: Anemarrhena21_contig00017475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00017475 (255 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012072104.1| PREDICTED: phospho-N-acetylmuramoyl-pentapep... 96 9e-18 ref|XP_012072103.1| PREDICTED: 40S ribosomal protein S14-3 isofo... 96 9e-18 gb|EMS48223.1| 40S ribosomal protein S14 [Triticum urartu] 95 2e-17 ref|XP_002519689.1| 40S ribosomal protein S14, putative [Ricinus... 95 2e-17 ref|XP_003575312.1| PREDICTED: 40S ribosomal protein S14 [Brachy... 94 3e-17 gb|EMS47995.1| 40S ribosomal protein S14 [Triticum urartu] 94 4e-17 dbj|BAJ93777.1| predicted protein [Hordeum vulgare subsp. vulgare] 94 4e-17 ref|XP_006430156.1| hypothetical protein CICLE_v10013022mg [Citr... 94 5e-17 ref|XP_007025102.1| Phospho-N-acetylmuramoyl-pentapeptide-transf... 94 5e-17 gb|EMT16829.1| 40S ribosomal protein S14 [Aegilops tauschii] 94 5e-17 ref|XP_011012389.1| PREDICTED: 40S ribosomal protein S14-like [P... 93 6e-17 ref|XP_010912312.1| PREDICTED: 40S ribosomal protein S14 [Elaeis... 93 6e-17 ref|XP_012076132.1| PREDICTED: 40S ribosomal protein S14 [Jatrop... 93 6e-17 ref|XP_002523830.1| 40S ribosomal protein S14, putative [Ricinus... 93 6e-17 ref|XP_002299781.2| hypothetical protein POPTR_0001s22620g [Popu... 93 6e-17 gb|ADV38313.1| putative ribosomal protein S14 [Wolffia arrhiza] 93 6e-17 ref|XP_002314245.1| 40S ribosomal protein S14-3 [Populus trichoc... 93 6e-17 ref|XP_006369385.1| hypothetical protein POPTR_0001s22620g [Popu... 93 6e-17 ref|XP_004149195.1| PREDICTED: 40S ribosomal protein S14-2 [Cucu... 92 1e-16 ref|XP_003563419.1| PREDICTED: 40S ribosomal protein S14-like [B... 92 1e-16 >ref|XP_012072104.1| PREDICTED: phospho-N-acetylmuramoyl-pentapeptide-transferase homolog isoform X2 [Jatropha curcas] Length = 626 Score = 95.9 bits (237), Expect = 9e-18 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = -2 Query: 161 LLCAAITMSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 ++ A +SKRKTREPKE+NVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 470 IIVAGAYVSKRKTREPKEENVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 522 >ref|XP_012072103.1| PREDICTED: 40S ribosomal protein S14-3 isoform X1 [Jatropha curcas] gi|643730539|gb|KDP37971.1| hypothetical protein JCGZ_04614 [Jatropha curcas] Length = 150 Score = 95.9 bits (237), Expect = 9e-18 Identities = 45/46 (97%), Positives = 46/46 (100%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MSKRKTREPKE+NVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSKRKTREPKEENVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 46 >gb|EMS48223.1| 40S ribosomal protein S14 [Triticum urartu] Length = 166 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/59 (77%), Positives = 52/59 (88%), Gaps = 1/59 (1%) Frame = -2 Query: 176 FGLRFL-LCAAITMSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 FG++ + L + SKRKTREPKE+NVTLGPAVREGEHVFGVAH+FASFNDTFIHVTDL Sbjct: 4 FGMKLVTLNLGYSSSKRKTREPKEENVTLGPAVREGEHVFGVAHVFASFNDTFIHVTDL 62 >ref|XP_002519689.1| 40S ribosomal protein S14, putative [Ricinus communis] gi|223541106|gb|EEF42662.1| 40S ribosomal protein S14, putative [Ricinus communis] Length = 150 Score = 94.7 bits (234), Expect = 2e-17 Identities = 44/46 (95%), Positives = 46/46 (100%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MSK+KTREPKE+NVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSKKKTREPKEENVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 46 >ref|XP_003575312.1| PREDICTED: 40S ribosomal protein S14 [Brachypodium distachyon] Length = 150 Score = 94.4 bits (233), Expect = 3e-17 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MSKRKTREPKE+NVTLGP VREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSKRKTREPKEENVTLGPTVREGEHVFGVAHIFASFNDTFIHVTDL 46 >gb|EMS47995.1| 40S ribosomal protein S14 [Triticum urartu] Length = 151 Score = 94.0 bits (232), Expect = 4e-17 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -2 Query: 137 SKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 SKRKTREPKE+NVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 3 SKRKTREPKEENVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 47 >dbj|BAJ93777.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 151 Score = 94.0 bits (232), Expect = 4e-17 Identities = 44/45 (97%), Positives = 45/45 (100%) Frame = -2 Query: 137 SKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 SKRKTREPKE+NVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 3 SKRKTREPKEENVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 47 >ref|XP_006430156.1| hypothetical protein CICLE_v10013022mg [Citrus clementina] gi|568856342|ref|XP_006481743.1| PREDICTED: 40S ribosomal protein S14-3-like [Citrus sinensis] gi|557532213|gb|ESR43396.1| hypothetical protein CICLE_v10013022mg [Citrus clementina] gi|641851614|gb|KDO70484.1| hypothetical protein CISIN_1g031952mg [Citrus sinensis] Length = 150 Score = 93.6 bits (231), Expect = 5e-17 Identities = 43/46 (93%), Positives = 46/46 (100%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MS+RKTREPKE+NVTLGPAVR+GEHVFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSRRKTREPKEENVTLGPAVRDGEHVFGVAHIFASFNDTFIHVTDL 46 >ref|XP_007025102.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Theobroma cacao] gi|508780468|gb|EOY27724.1| Phospho-N-acetylmuramoyl-pentapeptide-transferase [Theobroma cacao] Length = 655 Score = 93.6 bits (231), Expect = 5e-17 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -2 Query: 161 LLCAAITMSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 ++ A +S+RKTREPKE+N+TLGPAVREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 499 MIVAVAYISRRKTREPKEENLTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 551 >gb|EMT16829.1| 40S ribosomal protein S14 [Aegilops tauschii] Length = 198 Score = 93.6 bits (231), Expect = 5e-17 Identities = 43/45 (95%), Positives = 45/45 (100%) Frame = -2 Query: 137 SKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 SKRKTREPKE+NVTLGPAVREGEHVFGVAH+FASFNDTFIHVTDL Sbjct: 50 SKRKTREPKEENVTLGPAVREGEHVFGVAHVFASFNDTFIHVTDL 94 >ref|XP_011012389.1| PREDICTED: 40S ribosomal protein S14-like [Populus euphratica] Length = 92 Score = 93.2 bits (230), Expect = 6e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MS+RKTREPKE+NVTLGP VREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSRRKTREPKEENVTLGPTVREGEHVFGVAHIFASFNDTFIHVTDL 46 >ref|XP_010912312.1| PREDICTED: 40S ribosomal protein S14 [Elaeis guineensis] gi|743818080|ref|XP_010931115.1| PREDICTED: 40S ribosomal protein S14 [Elaeis guineensis] gi|743830177|ref|XP_010934348.1| PREDICTED: 40S ribosomal protein S14 [Elaeis guineensis] Length = 150 Score = 93.2 bits (230), Expect = 6e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MS+RKTREPKE+NVTLGP VREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSRRKTREPKEENVTLGPTVREGEHVFGVAHIFASFNDTFIHVTDL 46 >ref|XP_012076132.1| PREDICTED: 40S ribosomal protein S14 [Jatropha curcas] gi|643725321|gb|KDP34424.1| hypothetical protein JCGZ_12705 [Jatropha curcas] Length = 150 Score = 93.2 bits (230), Expect = 6e-17 Identities = 42/46 (91%), Positives = 46/46 (100%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MS++KTREPKE+NVTLGPA+REGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSRKKTREPKEENVTLGPAIREGEHVFGVAHIFASFNDTFIHVTDL 46 >ref|XP_002523830.1| 40S ribosomal protein S14, putative [Ricinus communis] gi|223536918|gb|EEF38556.1| 40S ribosomal protein S14, putative [Ricinus communis] Length = 150 Score = 93.2 bits (230), Expect = 6e-17 Identities = 42/46 (91%), Positives = 46/46 (100%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MSK+KTREPKE+NVTLGPA+REGEHVFGVAHI+ASFNDTFIHVTDL Sbjct: 1 MSKKKTREPKEENVTLGPAIREGEHVFGVAHIYASFNDTFIHVTDL 46 >ref|XP_002299781.2| hypothetical protein POPTR_0001s22620g [Populus trichocarpa] gi|550347908|gb|EEE84586.2| hypothetical protein POPTR_0001s22620g [Populus trichocarpa] Length = 133 Score = 93.2 bits (230), Expect = 6e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MSKR+TREPKE+NVTLGP VREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSKRRTREPKEENVTLGPTVREGEHVFGVAHIFASFNDTFIHVTDL 46 >gb|ADV38313.1| putative ribosomal protein S14 [Wolffia arrhiza] Length = 150 Score = 93.2 bits (230), Expect = 6e-17 Identities = 42/46 (91%), Positives = 46/46 (100%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MS+RKTREPKE+NVTLGPAVR+GEHVFGVAH+FASFNDTFIHVTDL Sbjct: 1 MSRRKTREPKEENVTLGPAVRDGEHVFGVAHVFASFNDTFIHVTDL 46 >ref|XP_002314245.1| 40S ribosomal protein S14-3 [Populus trichocarpa] gi|118483965|gb|ABK93870.1| unknown [Populus trichocarpa] gi|222850653|gb|EEE88200.1| 40S ribosomal protein S14-3 [Populus trichocarpa] Length = 150 Score = 93.2 bits (230), Expect = 6e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MS+RKTREPKE+NVTLGP VREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSRRKTREPKEENVTLGPTVREGEHVFGVAHIFASFNDTFIHVTDL 46 >ref|XP_006369385.1| hypothetical protein POPTR_0001s22620g [Populus trichocarpa] gi|743923912|ref|XP_011006063.1| PREDICTED: 40S ribosomal protein S14 [Populus euphratica] gi|743931459|ref|XP_011010001.1| PREDICTED: 40S ribosomal protein S14 [Populus euphratica] gi|118481419|gb|ABK92652.1| unknown [Populus trichocarpa] gi|550347907|gb|ERP65954.1| hypothetical protein POPTR_0001s22620g [Populus trichocarpa] Length = 150 Score = 93.2 bits (230), Expect = 6e-17 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MSKR+TREPKE+NVTLGP VREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSKRRTREPKEENVTLGPTVREGEHVFGVAHIFASFNDTFIHVTDL 46 >ref|XP_004149195.1| PREDICTED: 40S ribosomal protein S14-2 [Cucumis sativus] gi|449462948|ref|XP_004149197.1| PREDICTED: 40S ribosomal protein S14-2 [Cucumis sativus] gi|659084393|ref|XP_008442863.1| PREDICTED: 40S ribosomal protein S14-2 [Cucumis melo] gi|659084396|ref|XP_008442864.1| PREDICTED: 40S ribosomal protein S14-2 [Cucumis melo] gi|700204018|gb|KGN59151.1| hypothetical protein Csa_3G777590 [Cucumis sativus] gi|700204020|gb|KGN59153.1| hypothetical protein Csa_3G777610 [Cucumis sativus] Length = 150 Score = 92.4 bits (228), Expect = 1e-16 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MS+RKTREPKE+ VTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSRRKTREPKEETVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 46 >ref|XP_003563419.1| PREDICTED: 40S ribosomal protein S14-like [Brachypodium distachyon] Length = 150 Score = 92.4 bits (228), Expect = 1e-16 Identities = 44/46 (95%), Positives = 45/46 (97%) Frame = -2 Query: 140 MSKRKTREPKEDNVTLGPAVREGEHVFGVAHIFASFNDTFIHVTDL 3 MSKRKTREPKE+NVTLGPAVREGE VFGVAHIFASFNDTFIHVTDL Sbjct: 1 MSKRKTREPKEENVTLGPAVREGEFVFGVAHIFASFNDTFIHVTDL 46