BLASTX nr result
ID: Anemarrhena21_contig00017448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00017448 (220 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010921179.1| PREDICTED: serine/threonine-protein kinase A... 60 6e-07 ref|XP_008810846.1| PREDICTED: serine/threonine-protein kinase A... 58 2e-06 ref|XP_010938032.1| PREDICTED: serine/threonine-protein kinase A... 57 4e-06 >ref|XP_010921179.1| PREDICTED: serine/threonine-protein kinase AtPK2/AtPK19-like [Elaeis guineensis] Length = 480 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = -3 Query: 107 MVSSQISGLTKTNVQKTFKKQVLLPMGPPDVVPSE 3 MVSSQISGLT+T+V K+FK+Q+LLPMGPPDVV SE Sbjct: 1 MVSSQISGLTRTHVDKSFKRQILLPMGPPDVVLSE 35 >ref|XP_008810846.1| PREDICTED: serine/threonine-protein kinase AtPK2/AtPK19-like [Phoenix dactylifera] Length = 489 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -3 Query: 107 MVSSQISGLTKTNVQKTFKKQVLLPMGPPDVVPSE 3 MVSSQISGLT+T+ K+FK+Q+LLPM PPDVVPSE Sbjct: 1 MVSSQISGLTRTHGDKSFKRQILLPMHPPDVVPSE 35 >ref|XP_010938032.1| PREDICTED: serine/threonine-protein kinase AtPK2/AtPK19-like [Elaeis guineensis] Length = 489 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/35 (71%), Positives = 33/35 (94%) Frame = -3 Query: 107 MVSSQISGLTKTNVQKTFKKQVLLPMGPPDVVPSE 3 MVSSQISGLT+T+ +K+FK+Q+LLP+ PPD+VPSE Sbjct: 1 MVSSQISGLTRTHAEKSFKRQMLLPVHPPDIVPSE 35