BLASTX nr result
ID: Anemarrhena21_contig00017034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00017034 (323 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008797329.1| PREDICTED: mediator of RNA polymerase II tra... 37 6e-06 >ref|XP_008797329.1| PREDICTED: mediator of RNA polymerase II transcription subunit 27 [Phoenix dactylifera] gi|672150295|ref|XP_008797330.1| PREDICTED: mediator of RNA polymerase II transcription subunit 27 [Phoenix dactylifera] Length = 425 Score = 37.0 bits (84), Expect(3) = 6e-06 Identities = 14/24 (58%), Positives = 20/24 (83%) Frame = -3 Query: 150 IIVNVRLASDHLIEALFTSADAPH 79 +I ++RL +DHL+EALF +AD PH Sbjct: 45 LIADIRLGADHLLEALFLAADGPH 68 Score = 30.8 bits (68), Expect(3) = 6e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -2 Query: 61 QLILK*ESSMLQHFQDLR 8 Q+ILK E+SM QHFQDLR Sbjct: 75 QIILKEEASMRQHFQDLR 92 Score = 27.7 bits (60), Expect(3) = 6e-06 Identities = 17/38 (44%), Positives = 24/38 (63%), Gaps = 2/38 (5%) Frame = -1 Query: 272 KMPQAPAASALH-QDPSNSR-RSTETPPKRMEMAM*RL 165 + PQA + A QDP +S +TE PPK++ +AM RL Sbjct: 2 QQPQAAVSGAAPPQDPPDSGGATTEAPPKQVALAMDRL 39