BLASTX nr result
ID: Anemarrhena21_contig00016737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00016737 (314 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriod... 91 2e-16 ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoeni... 87 6e-15 gb|AHA47111.1| ribosomal protein L2 (mitochondrion) [Amborella t... 81 2e-13 gb|AHC94302.1| ribosomal protein L2, partial (mitochondrion) [Am... 77 4e-12 ref|YP_514664.1| ribosomal protein L2 (mitochondrion) [Oryza sat... 76 8e-12 sp|P92812.2|RM02_ORYSJ RecName: Full=60S ribosomal protein L2, m... 76 8e-12 ref|YP_003433878.1| ribosomal protein large subunit 2 (mitochond... 71 2e-10 ref|YP_009121961.1| ribosomal protein L2 (mitochondrion) [Hyoscy... 65 2e-08 ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] gi|756... 64 3e-08 ref|YP_009049780.1| ribosomal protein L2 (mitochondrion) [Capsic... 64 3e-08 gb|AIG89877.1| ribosomal protein L2 (mitochondrion) [Capsicum an... 64 3e-08 ref|YP_004927575.1| rpl2 (mitochondrion) [Brassica carinata] gi|... 64 3e-08 dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana ... 64 3e-08 ref|XP_010314947.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma... 64 4e-08 ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccin... 64 5e-08 gb|AGY62795.1| ribosomal protein L2 (mitochondrion) [Eruca vesic... 63 9e-08 dbj|BAP15873.1| ribosomal protein large subunit 2 (mitochondrion... 63 9e-08 gb|AEX57682.1| ribosomal protein L2 (mitochondrion) [Raphanus sa... 63 9e-08 ref|YP_006666008.1| ribosomal protein large subunit 2 (mitochond... 63 9e-08 ref|YP_717157.1| ribosomal protein L2 [Brassica napus] gi|375911... 62 1e-07 >ref|YP_007905729.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] gi|480541934|gb|AGJ90427.1| ribosomal protein L2 (mitochondrion) [Liriodendron tulipifera] Length = 554 Score = 91.3 bits (225), Expect = 2e-16 Identities = 58/116 (50%), Positives = 71/116 (61%), Gaps = 24/116 (20%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNS--------LPLKNSVGGKL--------- 173 ESKPK DQGS LLP+QVL+Y L G+PSYQN+ LP++ S G L Sbjct: 262 ESKPKADQGS-LLPSQVLAYALCSGRPSYQNASRSFYKALLPVEASRFGSLPAKPIGEGP 320 Query: 172 -----KVDQVPVSYIIASDKLEAGKTVMNCAWSEPSQSCAL--ATNSDTQRRLQDI 26 KVD+ PV+YI+AS +LEAGK VMNC WS+PS S L A N+ T R QD+ Sbjct: 321 KDGACKVDRAPVTYILASHQLEAGKMVMNCDWSKPSTSGFLRPAQNAHTYLRFQDL 376 >ref|YP_005090371.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] gi|343478424|gb|AEM43912.1| ribosomal protein L2 (mitochondrion) [Phoenix dactylifera] Length = 558 Score = 86.7 bits (213), Expect = 6e-15 Identities = 58/118 (49%), Positives = 71/118 (60%), Gaps = 26/118 (22%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNS--------LPLKNSVGGKL--------- 173 ESKPK DQGS LLP QVL+Y L G+PSYQN+ LP++ S G L Sbjct: 264 ESKPKADQGS-LLPRQVLAYALCSGRPSYQNASRSFYKALLPVEASRFGSLPAKPIGEGP 322 Query: 172 -----KVDQVPV--SYIIASDKLEAGKTVMNCAWSEPSQSCAL--ATNSDTQRRLQDI 26 KVD+ PV +YI+AS +LEAGK VMNC WS+PS+S L A N+ T R QD+ Sbjct: 323 KDGACKVDRAPVVNTYILASHQLEAGKMVMNCDWSKPSKSGFLRPAQNAHTYLRFQDL 380 >gb|AHA47111.1| ribosomal protein L2 (mitochondrion) [Amborella trichopoda] Length = 632 Score = 81.3 bits (199), Expect = 2e-13 Identities = 54/116 (46%), Positives = 69/116 (59%), Gaps = 24/116 (20%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNS--------LPLKNSVGGKL--------- 173 ESKPK DQGS LLP+QVL+ L RG+PSYQ++ LP++ S G L Sbjct: 343 ESKPKADQGS-LLPSQVLACALLRGRPSYQSASRSFVEALLPVEASRFGSLPAKPIGEGP 401 Query: 172 -----KVDQVPVSYIIASDKLEAGKTVMNCAWSEPSQSCAL--ATNSDTQRRLQDI 26 KV + PV+YI+AS +LE GK VMNC WS+PS S L A N+ T R +D+ Sbjct: 402 KDGACKVFRAPVTYILASHQLEVGKMVMNCDWSKPSTSGFLRPAQNAHTYLRFKDL 457 >gb|AHC94302.1| ribosomal protein L2, partial (mitochondrion) [Amborella trichopoda] Length = 429 Score = 77.0 bits (188), Expect = 4e-12 Identities = 48/98 (48%), Positives = 60/98 (61%), Gaps = 22/98 (22%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNS--------LPLKNSVGGKL--------- 173 ESKPK DQGS LLP+QVL+ L RG+PSYQ++ LP++ S G L Sbjct: 332 ESKPKADQGS-LLPSQVLACALLRGRPSYQSASRSFVEALLPVEASRFGSLPAKPIGEGP 390 Query: 172 -----KVDQVPVSYIIASDKLEAGKTVMNCAWSEPSQS 74 KV + PV+YI+AS +LE GK VMNC WS+PS S Sbjct: 391 KDGACKVFRAPVTYILASHQLEVGKMVMNCDWSKPSTS 428 >ref|YP_514664.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|194033244|ref|YP_002000581.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|23495405|dbj|BAC19886.1| Ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|74100083|gb|AAZ99247.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|74100138|gb|AAZ99301.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|74100192|gb|AAZ99354.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] gi|353685231|gb|AER12994.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|353685298|gb|AER13060.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|374277621|gb|AEZ03727.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|374277672|gb|AEZ03777.1| ribosomal protein L2 (mitochondrion) [Oryza sativa Indica Group] gi|528540449|dbj|BAN67503.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|528540486|dbj|BAN67539.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] Length = 502 Score = 76.3 bits (186), Expect = 8e-12 Identities = 52/117 (44%), Positives = 66/117 (56%), Gaps = 25/117 (21%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQN------------------SLPLKNSVG-- 182 ESK K DQGS LLP QVL+Y L G+PSY + SLP K +G Sbjct: 209 ESKLKADQGS-LLPRQVLAYALCSGRPSYLHASRSFYKALLPVEASRFGSLPAKPPIGEG 267 Query: 181 ---GKLKVDQVPVSYIIASDKLEAGKTVMNCAWSEPSQSCAL--ATNSDTQRRLQDI 26 G KVD+ PV+YI+AS +LEAG V+NC S+PS+S L A N+ T R Q++ Sbjct: 268 PKDGAYKVDRAPVTYILASHQLEAGNMVINCDCSKPSKSGFLRPAQNAHTYLRFQEL 324 >sp|P92812.2|RM02_ORYSJ RecName: Full=60S ribosomal protein L2, mitochondrial gi|218547415|sp|P0C8K6.1|RM02_ORYSA RecName: Full=60S ribosomal protein L2, mitochondrial gi|218551750|sp|Q2F969.2|RM02_ORYSI RecName: Full=60S ribosomal protein L2, mitochondrial gi|193240423|dbj|BAA11350.2| ribosomal protein L2 (mitochondrion) [Oryza sativa Japonica Group] Length = 502 Score = 76.3 bits (186), Expect = 8e-12 Identities = 52/117 (44%), Positives = 66/117 (56%), Gaps = 25/117 (21%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQN------------------SLPLKNSVG-- 182 ESK K DQGS LLP QVL+Y L G+PSY + SLP K +G Sbjct: 209 ESKLKADQGS-LLPRQVLAYALCSGRPSYLHASRSFYKALLPVEASRFGSLPAKPPIGEG 267 Query: 181 ---GKLKVDQVPVSYIIASDKLEAGKTVMNCAWSEPSQSCAL--ATNSDTQRRLQDI 26 G KVD+ PV+YI+AS +LEAG V+NC S+PS+S L A N+ T R Q++ Sbjct: 268 PKDGAYKVDRAPVTYILASHQLEAGNMVINCDCSKPSKSGFLRPAQNAHTYLRFQEL 324 >ref|YP_003433878.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|285026149|dbj|BAI67982.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza rufipogon] gi|285026205|dbj|BAI68037.1| ribosomal protein large subunit 2 (mitochondrion) [Oryza sativa Indica Group] Length = 504 Score = 71.2 bits (173), Expect = 2e-10 Identities = 52/119 (43%), Positives = 66/119 (55%), Gaps = 27/119 (22%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQN------------------SLPLKNSVG-- 182 ESK K DQGS LLP QVL+Y L G+PSY + SLP K +G Sbjct: 209 ESKLKADQGS-LLPRQVLAYALCSGRPSYLHASRSFYKALLPVEASRFGSLPAKPPIGEG 267 Query: 181 ---GKLKVDQVPV--SYIIASDKLEAGKTVMNCAWSEPSQSCAL--ATNSDTQRRLQDI 26 G KVD+ PV +YI+AS +LEAG V+NC S+PS+S L A N+ T R Q++ Sbjct: 268 PKDGAYKVDRAPVVNTYILASHQLEAGNMVINCDCSKPSKSGFLRPAQNAHTYLRFQEL 326 >ref|YP_009121961.1| ribosomal protein L2 (mitochondrion) [Hyoscyamus niger] gi|756142178|gb|AJK91389.1| ribosomal protein L2 (mitochondrion) [Hyoscyamus niger] Length = 331 Score = 64.7 bits (156), Expect = 2e-08 Identities = 42/87 (48%), Positives = 50/87 (57%), Gaps = 2/87 (2%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIASDKLE 122 ESKPK+DQGS LP + + GL G KVD+ PV+YIIAS +LE Sbjct: 262 ESKPKMDQGS--LPAKPIGEGLK----------------DGTCKVDRAPVTYIIASHQLE 303 Query: 121 AGKTVMNCAWSEPSQSCAL--ATNSDT 47 AGK VMNC WS+PS S L A N+ T Sbjct: 304 AGKMVMNCDWSKPSTSDLLRPAQNAHT 330 >ref|YP_173485.1| ribosomal protein L2 [Nicotiana tabacum] gi|756762100|gb|AJM70209.1| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum/Hyoscyamus niger cybrid] Length = 331 Score = 64.3 bits (155), Expect = 3e-08 Identities = 42/87 (48%), Positives = 49/87 (56%), Gaps = 2/87 (2%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIASDKLE 122 ESKPK DQGS LP + + GL G KVD+ PV+YIIAS +LE Sbjct: 262 ESKPKTDQGS--LPAKPIGEGLK----------------DGTCKVDRAPVTYIIASHQLE 303 Query: 121 AGKTVMNCAWSEPSQSCAL--ATNSDT 47 AGK VMNC WS+PS S L A N+ T Sbjct: 304 AGKMVMNCDWSKPSTSDLLRPAQNAHT 330 >ref|YP_009049780.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] gi|667752052|gb|AIG90138.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] Length = 332 Score = 64.3 bits (155), Expect = 3e-08 Identities = 42/87 (48%), Positives = 49/87 (56%), Gaps = 2/87 (2%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIASDKLE 122 ESKPK DQGS LP + + GL G KVD+ PV+YIIAS +LE Sbjct: 263 ESKPKTDQGS--LPAKPIGEGLK----------------DGTCKVDRAPVTYIIASHQLE 304 Query: 121 AGKTVMNCAWSEPSQSCAL--ATNSDT 47 AGK VMNC WS+PS S L A N+ T Sbjct: 305 AGKMVMNCDWSKPSTSDLLRPAQNAHT 331 >gb|AIG89877.1| ribosomal protein L2 (mitochondrion) [Capsicum annuum] Length = 329 Score = 64.3 bits (155), Expect = 3e-08 Identities = 42/87 (48%), Positives = 49/87 (56%), Gaps = 2/87 (2%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIASDKLE 122 ESKPK DQGS LP + + GL G KVD+ PV+YIIAS +LE Sbjct: 260 ESKPKTDQGS--LPAKPIGEGLK----------------DGTCKVDRAPVTYIIASHQLE 301 Query: 121 AGKTVMNCAWSEPSQSCAL--ATNSDT 47 AGK VMNC WS+PS S L A N+ T Sbjct: 302 AGKMVMNCDWSKPSTSDLLRPAQNAHT 328 >ref|YP_004927575.1| rpl2 (mitochondrion) [Brassica carinata] gi|335355036|gb|AEH43590.1| rpl2 [Brassica carinata] gi|775463839|dbj|BAQ95239.1| ribosomal protein large subunit 2 (mitochondrion) [Brassica nigra] Length = 349 Score = 64.3 bits (155), Expect = 3e-08 Identities = 44/94 (46%), Positives = 57/94 (60%), Gaps = 1/94 (1%) Frame = -2 Query: 313 SGFVESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIAS 134 +G +SKPK DQGS LP + + G + Q L K+ G KVD+ PV+YIIAS Sbjct: 260 AGHNKSKPKTDQGS--LPAKPI--GETAKQLKALRGLRAKD---GACKVDRAPVTYIIAS 312 Query: 133 DKLEAGKTVMNCAWSEPSQSCAL-ATNSDTQRRL 35 +LEAGK VMNC WS+PS S L +T +D + L Sbjct: 313 HQLEAGKMVMNCDWSKPSTSSFLQSTQNDHPKPL 346 >dbj|BAD83551.2| ribosomal protein L2 (mitochondrion) [Nicotiana tabacum] Length = 331 Score = 64.3 bits (155), Expect = 3e-08 Identities = 42/87 (48%), Positives = 49/87 (56%), Gaps = 2/87 (2%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIASDKLE 122 ESKPK DQGS LP + + GL G KVD+ PV+YIIAS +LE Sbjct: 262 ESKPKTDQGS--LPAKPIGEGLK----------------DGTCKVDRAPVTYIIASHQLE 303 Query: 121 AGKTVMNCAWSEPSQSCAL--ATNSDT 47 AGK VMNC WS+PS S L A N+ T Sbjct: 304 AGKMVMNCDWSKPSTSDLLRPAQNAHT 330 >ref|XP_010314947.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L2, mitochondrial, partial [Solanum lycopersicum] Length = 323 Score = 63.9 bits (154), Expect = 4e-08 Identities = 42/87 (48%), Positives = 49/87 (56%), Gaps = 2/87 (2%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIASDKLE 122 ESKPK DQGS LP + + GL G KVD+ PV+YIIAS +LE Sbjct: 254 ESKPKTDQGS--LPAKPIGEGLK----------------DGTRKVDRAPVTYIIASHQLE 295 Query: 121 AGKTVMNCAWSEPSQSCAL--ATNSDT 47 AGK VMNC WS+PS S L A N+ T Sbjct: 296 AGKMVMNCDWSKPSTSDLLRPAQNAHT 322 >ref|YP_008999589.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] gi|549531664|gb|AGX28803.1| ribosomal protein L2 (mitochondrion) [Vaccinium macrocarpon] Length = 335 Score = 63.5 bits (153), Expect = 5e-08 Identities = 41/87 (47%), Positives = 49/87 (56%), Gaps = 2/87 (2%) Frame = -2 Query: 301 ESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIASDKLE 122 ESKPK DQGS LP + + G G+ KVD+ PV+YIIAS +LE Sbjct: 266 ESKPKTDQGS--LPAKPIGEGTK----------------DGRCKVDRAPVTYIIASHELE 307 Query: 121 AGKTVMNCAWSEPSQSCAL--ATNSDT 47 AGK VMNC WS+PS S L A N+ T Sbjct: 308 AGKMVMNCDWSKPSTSDLLRPAQNAHT 334 >gb|AGY62795.1| ribosomal protein L2 (mitochondrion) [Eruca vesicaria subsp. sativa] Length = 349 Score = 62.8 bits (151), Expect = 9e-08 Identities = 41/83 (49%), Positives = 50/83 (60%) Frame = -2 Query: 313 SGFVESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIAS 134 +G +SKPK DQGS LP + + G Q L K+ G KVD+ PV+YIIAS Sbjct: 260 AGHNKSKPKTDQGS--LPAKPI--GERAKQLKALRGLRAKD---GACKVDRAPVTYIIAS 312 Query: 133 DKLEAGKTVMNCAWSEPSQSCAL 65 +LEAGK VMNC WS+PS S L Sbjct: 313 HQLEAGKMVMNCDWSKPSTSSFL 335 >dbj|BAP15873.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] Length = 349 Score = 62.8 bits (151), Expect = 9e-08 Identities = 41/83 (49%), Positives = 50/83 (60%) Frame = -2 Query: 313 SGFVESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIAS 134 +G +SKPK DQGS LP + + G Q L K+ G KVD+ PV+YIIAS Sbjct: 260 AGHNKSKPKTDQGS--LPAKPI--GERAKQLKALRGLRAKD---GACKVDRAPVTYIIAS 312 Query: 133 DKLEAGKTVMNCAWSEPSQSCAL 65 +LEAGK VMNC WS+PS S L Sbjct: 313 HQLEAGKMVMNCDWSKPSTSSFL 335 >gb|AEX57682.1| ribosomal protein L2 (mitochondrion) [Raphanus sativus] Length = 349 Score = 62.8 bits (151), Expect = 9e-08 Identities = 41/83 (49%), Positives = 50/83 (60%) Frame = -2 Query: 313 SGFVESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIAS 134 +G +SKPK DQGS LP + + G Q L K+ G KVD+ PV+YIIAS Sbjct: 260 AGHNKSKPKTDQGS--LPAKPI--GERAKQLKALRGLRAKD---GACKVDRAPVTYIIAS 312 Query: 133 DKLEAGKTVMNCAWSEPSQSCAL 65 +LEAGK VMNC WS+PS S L Sbjct: 313 HQLEAGKMVMNCDWSKPSTSSFL 335 >ref|YP_006666008.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|400278283|dbj|BAM36207.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|400278329|dbj|BAM36252.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] gi|443298136|gb|AGC81680.1| ribosomal protein L2 (mitochondrion) [Raphanus sativus] gi|662020304|gb|AIE42593.1| ribosomal protein large subunit 2 (mitochondrion) [Raphanus sativus] Length = 349 Score = 62.8 bits (151), Expect = 9e-08 Identities = 41/83 (49%), Positives = 50/83 (60%) Frame = -2 Query: 313 SGFVESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIAS 134 +G +SKPK DQGS LP + + G Q L K+ G KVD+ PV+YIIAS Sbjct: 260 AGHNKSKPKTDQGS--LPAKPI--GERAKQLKALRGLRAKD---GACKVDRAPVTYIIAS 312 Query: 133 DKLEAGKTVMNCAWSEPSQSCAL 65 +LEAGK VMNC WS+PS S L Sbjct: 313 HQLEAGKMVMNCDWSKPSTSSFL 335 >ref|YP_717157.1| ribosomal protein L2 [Brassica napus] gi|37591104|dbj|BAC98906.1| ribosomal protein L2 [Brassica napus] Length = 349 Score = 62.4 bits (150), Expect = 1e-07 Identities = 40/80 (50%), Positives = 49/80 (61%) Frame = -2 Query: 313 SGFVESKPKVDQGSSLLPNQVLSYGLSRGQPSYQNSLPLKNSVGGKLKVDQVPVSYIIAS 134 +G +SKPK DQGS LP + + G Q L K+ G KVD+ PV+YIIAS Sbjct: 260 AGHNKSKPKTDQGS--LPAKPI--GERAKQLKALRGLRAKD---GACKVDRAPVTYIIAS 312 Query: 133 DKLEAGKTVMNCAWSEPSQS 74 +LEAGK VMNC WS+PS S Sbjct: 313 HQLEAGKMVMNCDWSKPSTS 332