BLASTX nr result
ID: Anemarrhena21_contig00016473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00016473 (1616 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010926893.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-07 ref|XP_008807162.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-07 ref|XP_008807161.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-07 ref|XP_009393288.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-06 ref|XP_009393287.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-06 ref|XP_008656745.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-06 ref|XP_003566988.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-06 ref|XP_002456122.1| hypothetical protein SORBIDRAFT_03g030920 [S... 62 1e-06 gb|EEE55166.1| hypothetical protein OsJ_02981 [Oryza sativa Japo... 61 2e-06 gb|EEC71257.1| hypothetical protein OsI_03237 [Oryza sativa Indi... 61 2e-06 dbj|BAD73375.1| pentatricopeptide (PPR) repeat-containing protei... 61 2e-06 ref|NP_001043842.2| Os01g0674700 [Oryza sativa Japonica Group] g... 61 2e-06 >ref|XP_010926893.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic [Elaeis guineensis] Length = 865 Score = 63.9 bits (154), Expect = 3e-07 Identities = 33/67 (49%), Positives = 46/67 (68%) Frame = -3 Query: 201 IEKRKHGSRAIDMQGRSAKSNTKLDKVYG*ESNFEDRAAFRTFKVFTDIQNRPRVLQMEL 22 +E K+GS A M G+ K + + + EDRAAF+TF+VFTD++NRPRVL+ME+ Sbjct: 256 MEAGKNGSNATKMHGKIYVQPDKFVQGDTDDIDIEDRAAFKTFEVFTDVRNRPRVLRMEM 315 Query: 21 EERIQKL 1 EERI +L Sbjct: 316 EERIHEL 322 >ref|XP_008807162.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X2 [Phoenix dactylifera] Length = 854 Score = 63.5 bits (153), Expect = 4e-07 Identities = 33/64 (51%), Positives = 47/64 (73%) Frame = -3 Query: 192 RKHGSRAIDMQGRSAKSNTKLDKVYG*ESNFEDRAAFRTFKVFTDIQNRPRVLQMELEER 13 RK+G +M G+ + K+ + + + EDRAAF+TF+VFTD++NRPRVL+ME+EER Sbjct: 263 RKNG----EMHGKIIVQSDKVVQSDSDDIDIEDRAAFKTFEVFTDVRNRPRVLRMEVEER 318 Query: 12 IQKL 1 IQKL Sbjct: 319 IQKL 322 >ref|XP_008807161.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X1 [Phoenix dactylifera] Length = 865 Score = 63.5 bits (153), Expect = 4e-07 Identities = 33/64 (51%), Positives = 47/64 (73%) Frame = -3 Query: 192 RKHGSRAIDMQGRSAKSNTKLDKVYG*ESNFEDRAAFRTFKVFTDIQNRPRVLQMELEER 13 RK+G +M G+ + K+ + + + EDRAAF+TF+VFTD++NRPRVL+ME+EER Sbjct: 263 RKNG----EMHGKIIVQSDKVVQSDSDDIDIEDRAAFKTFEVFTDVRNRPRVLRMEVEER 318 Query: 12 IQKL 1 IQKL Sbjct: 319 IQKL 322 >ref|XP_009393288.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X2 [Musa acuminata subsp. malaccensis] Length = 1086 Score = 62.4 bits (150), Expect = 1e-06 Identities = 27/35 (77%), Positives = 35/35 (100%) Frame = -3 Query: 105 NFEDRAAFRTFKVFTDIQNRPRVLQMELEERIQKL 1 +FEDRAAF+TF+VFTD++NRPRVL+ME+EERI+KL Sbjct: 503 DFEDRAAFKTFEVFTDVRNRPRVLRMEMEERIEKL 537 >ref|XP_009393287.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic isoform X1 [Musa acuminata subsp. malaccensis] Length = 1105 Score = 62.4 bits (150), Expect = 1e-06 Identities = 27/35 (77%), Positives = 35/35 (100%) Frame = -3 Query: 105 NFEDRAAFRTFKVFTDIQNRPRVLQMELEERIQKL 1 +FEDRAAF+TF+VFTD++NRPRVL+ME+EERI+KL Sbjct: 522 DFEDRAAFKTFEVFTDVRNRPRVLRMEMEERIEKL 556 >ref|XP_008656745.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic [Zea mays] gi|670432380|ref|XP_008656746.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic [Zea mays] gi|670432382|ref|XP_008656747.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic [Zea mays] gi|413950899|gb|AFW83548.1| hypothetical protein ZEAMMB73_840071 [Zea mays] Length = 956 Score = 62.4 bits (150), Expect = 1e-06 Identities = 26/36 (72%), Positives = 36/36 (100%) Frame = -3 Query: 108 SNFEDRAAFRTFKVFTDIQNRPRVLQMELEERIQKL 1 ++F+DRAAF+TF+VFTD++NRPR+L+ME+EERIQKL Sbjct: 376 TDFDDRAAFKTFEVFTDVRNRPRILRMEMEERIQKL 411 >ref|XP_003566988.1| PREDICTED: pentatricopeptide repeat-containing protein At1g30610, chloroplastic [Brachypodium distachyon] Length = 976 Score = 62.4 bits (150), Expect = 1e-06 Identities = 28/37 (75%), Positives = 35/37 (94%) Frame = -3 Query: 111 ESNFEDRAAFRTFKVFTDIQNRPRVLQMELEERIQKL 1 E+ +DRAAF+TF+VFTD++NRPRVLQME+EERIQKL Sbjct: 396 EAVIDDRAAFKTFEVFTDVRNRPRVLQMEIEERIQKL 432 >ref|XP_002456122.1| hypothetical protein SORBIDRAFT_03g030920 [Sorghum bicolor] gi|241928097|gb|EES01242.1| hypothetical protein SORBIDRAFT_03g030920 [Sorghum bicolor] Length = 937 Score = 62.4 bits (150), Expect = 1e-06 Identities = 26/36 (72%), Positives = 36/36 (100%) Frame = -3 Query: 108 SNFEDRAAFRTFKVFTDIQNRPRVLQMELEERIQKL 1 ++F+DRAAF+TF+VFTD++NRPR+L+ME+EERIQKL Sbjct: 359 TDFDDRAAFKTFEVFTDVRNRPRILRMEMEERIQKL 394 >gb|EEE55166.1| hypothetical protein OsJ_02981 [Oryza sativa Japonica Group] Length = 994 Score = 61.2 bits (147), Expect = 2e-06 Identities = 27/35 (77%), Positives = 34/35 (97%) Frame = -3 Query: 105 NFEDRAAFRTFKVFTDIQNRPRVLQMELEERIQKL 1 + +DRAAF+TF+VFTD++NRPRVLQMELE+RIQKL Sbjct: 413 DLDDRAAFKTFEVFTDVRNRPRVLQMELEDRIQKL 447 >gb|EEC71257.1| hypothetical protein OsI_03237 [Oryza sativa Indica Group] Length = 994 Score = 61.2 bits (147), Expect = 2e-06 Identities = 27/35 (77%), Positives = 34/35 (97%) Frame = -3 Query: 105 NFEDRAAFRTFKVFTDIQNRPRVLQMELEERIQKL 1 + +DRAAF+TF+VFTD++NRPRVLQMELE+RIQKL Sbjct: 413 DLDDRAAFKTFEVFTDVRNRPRVLQMELEDRIQKL 447 >dbj|BAD73375.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] gi|56202015|dbj|BAD73522.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza sativa Japonica Group] Length = 988 Score = 61.2 bits (147), Expect = 2e-06 Identities = 27/35 (77%), Positives = 34/35 (97%) Frame = -3 Query: 105 NFEDRAAFRTFKVFTDIQNRPRVLQMELEERIQKL 1 + +DRAAF+TF+VFTD++NRPRVLQMELE+RIQKL Sbjct: 413 DLDDRAAFKTFEVFTDVRNRPRVLQMELEDRIQKL 447 >ref|NP_001043842.2| Os01g0674700 [Oryza sativa Japonica Group] gi|255673547|dbj|BAF05756.2| Os01g0674700 [Oryza sativa Japonica Group] Length = 514 Score = 61.2 bits (147), Expect = 2e-06 Identities = 27/35 (77%), Positives = 34/35 (97%) Frame = -3 Query: 105 NFEDRAAFRTFKVFTDIQNRPRVLQMELEERIQKL 1 + +DRAAF+TF+VFTD++NRPRVLQMELE+RIQKL Sbjct: 413 DLDDRAAFKTFEVFTDVRNRPRVLQMELEDRIQKL 447