BLASTX nr result
ID: Anemarrhena21_contig00016309
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00016309 (1366 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519116.1| conserved hypothetical protein [Ricinus comm... 64 3e-07 >ref|XP_002519116.1| conserved hypothetical protein [Ricinus communis] gi|223541779|gb|EEF43327.1| conserved hypothetical protein [Ricinus communis] Length = 513 Score = 63.9 bits (154), Expect = 3e-07 Identities = 40/152 (26%), Positives = 81/152 (53%), Gaps = 2/152 (1%) Frame = -1 Query: 1363 SRVGGKNITLFVENLSRILVLSNRGHDVLEHTLHTFPYPMGHSEESASKLLHDDDNFALI 1184 S V GK I L ++L +I+ + N G ++ E+ +G S A K+L ++ + +++ Sbjct: 117 SFVKGKEIRLNQKSLKKIIGIPNFGTEICENDYKWVENDVGISRVEAFKMLLENPDSSVV 176 Query: 1183 SNDKISLFTPI-CQILAKIIIHNVVPKGGEFSSARGCVPILMFCILNSIPVNLPLMLF-H 1010 S+ + + ++L +++H ++P+ + ++M+ ILN + NLP +L H Sbjct: 177 SSKVDACHLKLEMRLLHLMVVHIILPRKRSLNCVSDMDLLVMWHILNGMDFNLPFVLLSH 236 Query: 1009 QMTSESLYHKNLPFGMILTVLFKHWGLDLSSE 914 + + LP+GM+LT++FKH+ + L E Sbjct: 237 MVACSEKKNAYLPYGMMLTLIFKHFKVSLEEE 268