BLASTX nr result
ID: Anemarrhena21_contig00016174
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00016174 (474 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009384415.1| PREDICTED: protein DEHYDRATION-INDUCED 19 ho... 57 4e-06 ref|XP_009382513.1| PREDICTED: protein DEHYDRATION-INDUCED 19 ho... 57 5e-06 >ref|XP_009384415.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 2-like [Musa acuminata subsp. malaccensis] Length = 236 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 472 VEPSLSDKDQKERACRSQFVQGLLLSTVFDD 380 VEPSLSDKDQKERA RS+FVQGL+LST+FDD Sbjct: 204 VEPSLSDKDQKERARRSEFVQGLVLSTIFDD 234 >ref|XP_009382513.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 2-like [Musa acuminata subsp. malaccensis] Length = 237 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 472 VEPSLSDKDQKERACRSQFVQGLLLSTVFDD 380 +EPSLSDKDQKERA RS+FVQGL+LST+FDD Sbjct: 205 IEPSLSDKDQKERAQRSEFVQGLVLSTIFDD 235