BLASTX nr result
ID: Anemarrhena21_contig00015677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00015677 (1426 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008243319.1| PREDICTED: protein starmaker [Prunus mume] g... 62 1e-06 ref|XP_010916293.1| PREDICTED: sarcoplasmic reticulum histidine-... 60 3e-06 ref|XP_009356178.1| PREDICTED: protein FAM133-like [Pyrus x bret... 60 3e-06 ref|XP_007222736.1| hypothetical protein PRUPE_ppa008721mg [Prun... 60 3e-06 ref|XP_010243755.1| PREDICTED: sarcoplasmic reticulum histidine-... 59 7e-06 ref|XP_008811788.1| PREDICTED: UPF0396 protein UM04995 [Phoenix ... 59 7e-06 ref|XP_010916296.1| PREDICTED: sarcoplasmic reticulum histidine-... 59 9e-06 >ref|XP_008243319.1| PREDICTED: protein starmaker [Prunus mume] gi|645276510|ref|XP_008243320.1| PREDICTED: protein starmaker [Prunus mume] Length = 334 Score = 61.6 bits (148), Expect = 1e-06 Identities = 25/48 (52%), Positives = 36/48 (75%) Frame = -3 Query: 491 HDRRSRSLGKSSEDNNDEPRRQMKSKKSHHRHAHPHRYRSHHQHEHNE 348 HD+RSRSLGKSS+DN+DE +Q++ K+S H + H H++R HH E + Sbjct: 254 HDKRSRSLGKSSDDNHDEAGKQLRHKRSAHHYHHHHKHRHHHLDEDRD 301 >ref|XP_010916293.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein-like [Elaeis guineensis] gi|743771997|ref|XP_010916294.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein-like [Elaeis guineensis] gi|743771999|ref|XP_010916295.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein-like [Elaeis guineensis] Length = 287 Score = 60.5 bits (145), Expect = 3e-06 Identities = 26/56 (46%), Positives = 39/56 (69%), Gaps = 2/56 (3%) Frame = -3 Query: 491 HDRRSRSLGKSSEDNNDEPRRQMKSKKSHHRHA--HPHRYRSHHQHEHNENSVALN 330 H+RRS S+GKSS+D+ +E +Q +KK HH+H H HR+ +H H+H+ NS+ N Sbjct: 214 HNRRSHSVGKSSDDDWEEVGKQRDTKKPHHKHGHHHHHRHHNHRHHDHHRNSMDSN 269 >ref|XP_009356178.1| PREDICTED: protein FAM133-like [Pyrus x bretschneideri] gi|694330991|ref|XP_009356179.1| PREDICTED: protein FAM133-like [Pyrus x bretschneideri] Length = 325 Score = 60.5 bits (145), Expect = 3e-06 Identities = 26/47 (55%), Positives = 33/47 (70%) Frame = -3 Query: 485 RRSRSLGKSSEDNNDEPRRQMKSKKSHHRHAHPHRYRSHHQHEHNEN 345 RRSRSLGKSS+DN DE +Q+K K+S H H H++R HH E +N Sbjct: 254 RRSRSLGKSSDDNRDEADKQLKHKRSGHHSHHHHKHRHHHSKEEKDN 300 >ref|XP_007222736.1| hypothetical protein PRUPE_ppa008721mg [Prunus persica] gi|462419672|gb|EMJ23935.1| hypothetical protein PRUPE_ppa008721mg [Prunus persica] Length = 321 Score = 60.5 bits (145), Expect = 3e-06 Identities = 26/48 (54%), Positives = 35/48 (72%) Frame = -3 Query: 491 HDRRSRSLGKSSEDNNDEPRRQMKSKKSHHRHAHPHRYRSHHQHEHNE 348 HDRRSRSLGKSS+DN+DE +Q++ K+S H H H++R HH E + Sbjct: 241 HDRRSRSLGKSSDDNHDEAGKQLRHKRSGHHCHHHHKHRYHHLDEDRD 288 >ref|XP_010243755.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein [Nelumbo nucifera] gi|720086167|ref|XP_010243756.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein [Nelumbo nucifera] gi|720086170|ref|XP_010243757.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein [Nelumbo nucifera] Length = 303 Score = 59.3 bits (142), Expect = 7e-06 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 1/49 (2%) Frame = -3 Query: 494 HHDR-RSRSLGKSSEDNNDEPRRQMKSKKSHHRHAHPHRYRSHHQHEHN 351 H D RS+SLGKSS+DN++E +Q + KK HHRH H H R HH H+ Sbjct: 219 HRDEGRSQSLGKSSDDNHEESGKQKRHKKCHHRHGHHHHRRHHHHKPHH 267 >ref|XP_008811788.1| PREDICTED: UPF0396 protein UM04995 [Phoenix dactylifera] gi|672183049|ref|XP_008811789.1| PREDICTED: UPF0396 protein UM04995 [Phoenix dactylifera] Length = 285 Score = 59.3 bits (142), Expect = 7e-06 Identities = 27/57 (47%), Positives = 36/57 (63%), Gaps = 2/57 (3%) Frame = -3 Query: 494 HHDRRSRSLGKSSEDNNDEPRRQMKSKKSHHRHAHPHRYR--SHHQHEHNENSVALN 330 H RS S+GKSS+DN +E +Q K+ HH+H H H YR +H H+H+ NSV N Sbjct: 211 HRHDRSHSVGKSSDDNWEEVGKQKDPKQPHHKHEHHHHYRHHNHRHHDHHRNSVDSN 267 >ref|XP_010916296.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein-like [Elaeis guineensis] gi|743772003|ref|XP_010916297.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein-like [Elaeis guineensis] gi|743772005|ref|XP_010916298.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein-like [Elaeis guineensis] Length = 287 Score = 58.9 bits (141), Expect = 9e-06 Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 2/56 (3%) Frame = -3 Query: 491 HDRRSRSLGKSSEDNNDEPRRQMKSKKSHHRHAHPH--RYRSHHQHEHNENSVALN 330 H+RRS S+GKSS+D+ +E +Q +KK HH+H H H R+ +H H+H+ N V N Sbjct: 214 HNRRSHSVGKSSDDDWEEVGKQRDTKKPHHKHEHHHHPRHHNHRHHDHHRNLVDSN 269