BLASTX nr result
ID: Anemarrhena21_contig00014134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00014134 (269 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGV54820.1| cell wall-associated hydrolase [Phaseolus vulgaris] 44 1e-06 ref|XP_003637074.1| Cell wall-associated hydrolase, partial [Med... 42 5e-06 >gb|AGV54820.1| cell wall-associated hydrolase [Phaseolus vulgaris] Length = 425 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 23/32 (71%), Positives = 24/32 (75%) Frame = -3 Query: 219 PLEYLQP*VAKS*HRGAIPFCRCELLGKISLI 124 P LQP VAKS HRGA P RCELLGKISL+ Sbjct: 95 PWNILQPQVAKSRHRGAKPSRRCELLGKISLL 126 Score = 34.7 bits (78), Expect(2) = 1e-06 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 245 TALIGEQPNPWNIYSPR 195 TAL+GEQPNPWNI P+ Sbjct: 86 TALMGEQPNPWNILQPQ 102 >ref|XP_003637074.1| Cell wall-associated hydrolase, partial [Medicago truncatula] Length = 733 Score = 42.0 bits (97), Expect(2) = 5e-06 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = -3 Query: 219 PLEYLQP*VAKS*HRGAIPFCRCELLGKIS 130 P LQP VAKS HRGA P RCELLGKIS Sbjct: 47 PWNILQPQVAKSRHRGAKPSRRCELLGKIS 76 Score = 34.7 bits (78), Expect(2) = 5e-06 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 245 TALIGEQPNPWNIYSPR 195 TAL+GEQPNPWNI P+ Sbjct: 38 TALMGEQPNPWNILQPQ 54