BLASTX nr result
ID: Anemarrhena21_contig00013669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00013669 (329 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010938645.1| PREDICTED: myosin heavy chain kinase B [Elae... 82 2e-13 ref|XP_008800269.1| PREDICTED: WD repeat-containing protein 5B [... 80 5e-13 ref|XP_010273313.1| PREDICTED: WD repeat-containing protein 5 ho... 79 1e-12 ref|XP_010067769.1| PREDICTED: myosin heavy chain kinase B [Euca... 78 3e-12 ref|XP_009382577.1| PREDICTED: WD repeat-containing protein 5 ho... 78 3e-12 gb|KCW65961.1| hypothetical protein EUGRSUZ_G03262 [Eucalyptus g... 78 3e-12 ref|XP_009139493.1| PREDICTED: WD repeat-containing protein 5 ho... 77 5e-12 emb|CDY23176.1| BnaA04g05830D [Brassica napus] 77 5e-12 ref|XP_006403866.1| hypothetical protein EUTSA_v10010951mg [Eutr... 77 5e-12 ref|XP_002304776.2| hypothetical protein POPTR_0003s20150g [Popu... 77 6e-12 ref|XP_007008790.1| Transducin/WD40 repeat-like superfamily prot... 76 8e-12 ref|XP_007219533.1| hypothetical protein PRUPE_ppa021557mg [Prun... 76 8e-12 ref|XP_012460936.1| PREDICTED: myosin heavy chain kinase B-like ... 76 1e-11 ref|NP_190761.1| transducin/WD40 domain-containing protein [Arab... 76 1e-11 ref|XP_012456835.1| PREDICTED: myosin heavy chain kinase B-like ... 75 1e-11 ref|XP_011042130.1| PREDICTED: myosin heavy chain kinase B-like ... 75 1e-11 ref|XP_009788826.1| PREDICTED: myosin heavy chain kinase B [Nico... 75 1e-11 ref|XP_009605008.1| PREDICTED: myosin heavy chain kinase B [Nico... 75 1e-11 ref|XP_008246105.1| PREDICTED: myosin heavy chain kinase B-like,... 75 1e-11 ref|XP_008231446.1| PREDICTED: myosin heavy chain kinase B-like ... 75 1e-11 >ref|XP_010938645.1| PREDICTED: myosin heavy chain kinase B [Elaeis guineensis] Length = 388 Score = 81.6 bits (200), Expect = 2e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPKEY 195 VG+IRG E PVKCL+AS VG+GFMLYSGGLDK LRVWWVPKEY Sbjct: 337 VGIIRGPEGPVKCLQASCYSVGEGFMLYSGGLDKSLRVWWVPKEY 381 >ref|XP_008800269.1| PREDICTED: WD repeat-containing protein 5B [Phoenix dactylifera] Length = 385 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/43 (81%), Positives = 38/43 (88%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPK 201 VGVIRGHE PVKCL+AS VG+GFMLYSGGLDK LRVWWVP+ Sbjct: 337 VGVIRGHEGPVKCLQASCYSVGEGFMLYSGGLDKSLRVWWVPR 379 >ref|XP_010273313.1| PREDICTED: WD repeat-containing protein 5 homolog [Nelumbo nucifera] Length = 409 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPKE 198 VGV+RGHE PVKCL+AS +G GF+LYSGGLDK LRVWWVPKE Sbjct: 347 VGVLRGHEGPVKCLQASPNSIGGGFLLYSGGLDKNLRVWWVPKE 390 >ref|XP_010067769.1| PREDICTED: myosin heavy chain kinase B [Eucalyptus grandis] Length = 439 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPK 201 VG+I GHE PVKCL+AS + VG+GFMLYSGGLDK LRVWWVPK Sbjct: 375 VGLISGHEGPVKCLQASPLRVGEGFMLYSGGLDKSLRVWWVPK 417 >ref|XP_009382577.1| PREDICTED: WD repeat-containing protein 5 homolog [Musa acuminata subsp. malaccensis] Length = 403 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPKEYG 192 VG+I GHEAPVKCL+AS VG+GFMLYSGGLD+ LRVWWV +E G Sbjct: 338 VGIIGGHEAPVKCLQASAHSVGEGFMLYSGGLDRSLRVWWVSREQG 383 >gb|KCW65961.1| hypothetical protein EUGRSUZ_G03262 [Eucalyptus grandis] Length = 418 Score = 77.8 bits (190), Expect = 3e-12 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPK 201 VG+I GHE PVKCL+AS + VG+GFMLYSGGLDK LRVWWVPK Sbjct: 354 VGLISGHEGPVKCLQASPLRVGEGFMLYSGGLDKSLRVWWVPK 396 >ref|XP_009139493.1| PREDICTED: WD repeat-containing protein 5 homolog [Brassica rapa] Length = 424 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPKE 198 VGVI+GHE PVKCL+AS VG GFMLYSGGLDK +RVWWVPK+ Sbjct: 361 VGVIQGHEGPVKCLQASPNNVGAGFMLYSGGLDKSIRVWWVPKQ 404 >emb|CDY23176.1| BnaA04g05830D [Brassica napus] Length = 424 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPKE 198 VGVI+GHE PVKCL+AS VG GFMLYSGGLDK +RVWWVPK+ Sbjct: 361 VGVIQGHEGPVKCLQASPNNVGAGFMLYSGGLDKSIRVWWVPKQ 404 >ref|XP_006403866.1| hypothetical protein EUTSA_v10010951mg [Eutrema salsugineum] gi|557104985|gb|ESQ45319.1| hypothetical protein EUTSA_v10010951mg [Eutrema salsugineum] Length = 421 Score = 77.0 bits (188), Expect = 5e-12 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPKE 198 +GVI+GHE PVKCL+AS VG GFMLYSGGLDK +RVWWVPK+ Sbjct: 359 IGVIQGHEGPVKCLQASPNNVGTGFMLYSGGLDKSIRVWWVPKQ 402 >ref|XP_002304776.2| hypothetical protein POPTR_0003s20150g [Populus trichocarpa] gi|550343600|gb|EEE79755.2| hypothetical protein POPTR_0003s20150g [Populus trichocarpa] Length = 419 Score = 76.6 bits (187), Expect = 6e-12 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPKE 198 +GVI GHE PVKCL+AS VG GF+LYSGGLDK LRVWWVPK+ Sbjct: 361 IGVINGHEGPVKCLQASPNNVGSGFLLYSGGLDKSLRVWWVPKQ 404 >ref|XP_007008790.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] gi|508725703|gb|EOY17600.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao] Length = 406 Score = 76.3 bits (186), Expect = 8e-12 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPK 201 VGVI GHE PVKCL+AS VG GF+LYSGGLDK +RVWWVPK Sbjct: 355 VGVINGHEGPVKCLQASPCNVGSGFLLYSGGLDKSIRVWWVPK 397 >ref|XP_007219533.1| hypothetical protein PRUPE_ppa021557mg [Prunus persica] gi|462415995|gb|EMJ20732.1| hypothetical protein PRUPE_ppa021557mg [Prunus persica] Length = 426 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPK 201 VG+I GHE PVKCL+AS VG GFMLYSGGLDK LRVWWVPK Sbjct: 366 VGIISGHEGPVKCLQASPNNVGGGFMLYSGGLDKSLRVWWVPK 408 >ref|XP_012460936.1| PREDICTED: myosin heavy chain kinase B-like [Gossypium raimondii] gi|763809348|gb|KJB76250.1| hypothetical protein B456_012G080600 [Gossypium raimondii] Length = 404 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPK 201 VGVI GHE PVKCL+AS VG GF+LYSGGLDK +RVWWVPK Sbjct: 357 VGVINGHEGPVKCLQASPCNVGTGFLLYSGGLDKSIRVWWVPK 399 >ref|NP_190761.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] gi|4678922|emb|CAB41313.1| putative protein [Arabidopsis thaliana] gi|30725344|gb|AAP37694.1| At3g51930 [Arabidopsis thaliana] gi|110736561|dbj|BAF00246.1| hypothetical protein [Arabidopsis thaliana] gi|332645343|gb|AEE78864.1| transducin/WD40 domain-containing protein [Arabidopsis thaliana] Length = 415 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -1 Query: 326 GVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPKE 198 GVI GHE PVKCL+AS VG GFMLYSGGLDK LRVWWVPK+ Sbjct: 355 GVIHGHEGPVKCLQASPNNVGAGFMLYSGGLDKSLRVWWVPKQ 397 >ref|XP_012456835.1| PREDICTED: myosin heavy chain kinase B-like [Gossypium raimondii] gi|763807496|gb|KJB74434.1| hypothetical protein B456_011G294900 [Gossypium raimondii] Length = 394 Score = 75.5 bits (184), Expect = 1e-11 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPKEY 195 +GVI GH+ P+KCL+AS VG+GF+LYSGGLDK +RVWWVPK + Sbjct: 348 IGVINGHQGPIKCLQASPCNVGNGFLLYSGGLDKTVRVWWVPKRF 392 >ref|XP_011042130.1| PREDICTED: myosin heavy chain kinase B-like [Populus euphratica] Length = 419 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/44 (75%), Positives = 36/44 (81%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPKE 198 VGVI GHE PVKCL+AS VG GF+LYSGG DK LRVWWVPK+ Sbjct: 361 VGVINGHEGPVKCLQASPNNVGSGFLLYSGGFDKSLRVWWVPKQ 404 >ref|XP_009788826.1| PREDICTED: myosin heavy chain kinase B [Nicotiana sylvestris] Length = 400 Score = 75.5 bits (184), Expect = 1e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVP 204 VGVI+GHE PVKCL+AS + VG GFMLYSG LDK LRVWW+P Sbjct: 357 VGVIKGHEGPVKCLQASPVSVGGGFMLYSGSLDKSLRVWWIP 398 >ref|XP_009605008.1| PREDICTED: myosin heavy chain kinase B [Nicotiana tomentosiformis] Length = 416 Score = 75.5 bits (184), Expect = 1e-11 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVP 204 VGVI+GHE PVKCL+AS + VG GFMLYSG LDK LRVWW+P Sbjct: 357 VGVIKGHEGPVKCLQASPVSVGGGFMLYSGSLDKSLRVWWIP 398 >ref|XP_008246105.1| PREDICTED: myosin heavy chain kinase B-like, partial [Prunus mume] Length = 367 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPK 201 VG+I GHE PVKCL+AS VG GFMLYSGGLDK LRVWWVPK Sbjct: 307 VGIISGHEGPVKCLQASPNTVGGGFMLYSGGLDKSLRVWWVPK 349 >ref|XP_008231446.1| PREDICTED: myosin heavy chain kinase B-like [Prunus mume] Length = 426 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -1 Query: 329 VGVIRGHEAPVKCLRASVIGVGDGFMLYSGGLDKRLRVWWVPK 201 VG+I GHE PVKCL+AS VG GFMLYSGGLDK LRVWWVPK Sbjct: 366 VGIISGHEGPVKCLQASPNTVGGGFMLYSGGLDKSLRVWWVPK 408