BLASTX nr result
ID: Anemarrhena21_contig00013164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00013164 (612 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009389359.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|XP_009416416.1| PREDICTED: mitochondrial import receptor sub... 90 7e-16 ref|XP_003530621.1| PREDICTED: mitochondrial import receptor sub... 90 1e-15 ref|XP_008810028.1| PREDICTED: mitochondrial import receptor sub... 89 1e-15 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 89 1e-15 ref|XP_008795046.1| PREDICTED: mitochondrial import receptor sub... 89 2e-15 ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prun... 88 3e-15 gb|AFK44684.1| unknown [Lotus japonicus] 88 3e-15 ref|XP_012463735.1| PREDICTED: mitochondrial import receptor sub... 88 4e-15 gb|KHG28073.1| Mitochondrial import receptor subunit TOM7-1 -lik... 88 4e-15 ref|XP_009406780.1| PREDICTED: mitochondrial import receptor sub... 87 5e-15 ref|XP_011623506.1| PREDICTED: mitochondrial import receptor sub... 87 8e-15 ref|XP_011077684.1| PREDICTED: mitochondrial import receptor sub... 87 8e-15 ref|XP_011077105.1| PREDICTED: mitochondrial import receptor sub... 87 8e-15 ref|XP_010263429.1| PREDICTED: mitochondrial import receptor sub... 87 8e-15 ref|XP_010046892.1| PREDICTED: mitochondrial import receptor sub... 87 8e-15 ref|XP_007160221.1| hypothetical protein PHAVU_002G303100g [Phas... 87 8e-15 ref|XP_009362070.1| PREDICTED: mitochondrial import receptor sub... 86 1e-14 ref|XP_012850170.1| PREDICTED: mitochondrial import receptor sub... 86 1e-14 ref|XP_006473187.1| PREDICTED: mitochondrial import receptor sub... 86 1e-14 >ref|XP_009389359.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Musa acuminata subsp. malaccensis] Length = 73 Score = 90.9 bits (224), Expect = 4e-16 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 KCVKEW+TWAMKKAKV+THYGFIPLIIVIGMNSEPKP L QL SPV Sbjct: 28 KCVKEWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQLYQLLSPV 73 >ref|XP_009416416.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] Length = 71 Score = 90.1 bits (222), Expect = 7e-16 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 KCVKEW+TWAMKKAKV+THYGFIPLI++IGMNSEPKP L QL SPV Sbjct: 26 KCVKEWSTWAMKKAKVITHYGFIPLIVIIGMNSEPKPQLYQLLSPV 71 >ref|XP_003530621.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|734363636|gb|KHN16697.1| Mitochondrial import receptor subunit TOM7-1 [Glycine soja] Length = 72 Score = 89.7 bits (221), Expect = 1e-15 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = -2 Query: 395 NKCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 ++C+KEWTTWAM+KAKV+THYGFIPL+IVIGMNS+PKP LSQL SPV Sbjct: 26 SECLKEWTTWAMRKAKVITHYGFIPLVIVIGMNSDPKPPLSQLLSPV 72 >ref|XP_008810028.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Phoenix dactylifera] Length = 72 Score = 89.4 bits (220), Expect = 1e-15 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 +CVK W+TWAMKKAKV+THYGFIPLII+IGMNSEPKP LSQL SPV Sbjct: 27 RCVKTWSTWAMKKAKVITHYGFIPLIIIIGMNSEPKPQLSQLLSPV 72 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|734310475|gb|KHM99855.1| Mitochondrial import receptor subunit TOM7-1 [Glycine soja] Length = 72 Score = 89.4 bits (220), Expect = 1e-15 Identities = 37/47 (78%), Positives = 45/47 (95%) Frame = -2 Query: 395 NKCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 ++C+KEWTTWAM+KAKV+THYGFIPL+I+IGMNS+PKP LSQL SPV Sbjct: 26 SECLKEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72 >ref|XP_008795046.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Phoenix dactylifera] Length = 69 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 +CVK+W+TWAMKKAKVV HYGFIPLIIVIGMNSEPKP LSQL SPV Sbjct: 24 RCVKDWSTWAMKKAKVVAHYGFIPLIIVIGMNSEPKPHLSQLVSPV 69 >ref|XP_007225789.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] gi|645234757|ref|XP_008223958.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Prunus mume] gi|462422725|gb|EMJ26988.1| hypothetical protein PRUPE_ppa014339mg [Prunus persica] Length = 73 Score = 88.2 bits (217), Expect = 3e-15 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -2 Query: 386 VKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 VKEW+TWAMKKAKVVTHYGFIPLIIVIGMNSEPKP LSQL SPV Sbjct: 30 VKEWSTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPQLSQLLSPV 73 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 88.2 bits (217), Expect = 3e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 +C+KEWTTW M+KAKVVTHYGFIPLII+IGMNS+PKP LSQL SPV Sbjct: 27 ECLKEWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 72 >ref|XP_012463735.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] gi|823261997|ref|XP_012463736.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] gi|763814322|gb|KJB81174.1| hypothetical protein B456_013G132400 [Gossypium raimondii] gi|763814323|gb|KJB81175.1| hypothetical protein B456_013G132400 [Gossypium raimondii] Length = 72 Score = 87.8 bits (216), Expect = 4e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 +C+KEW+TWAMKKAKVVTHYGFIPL+I+IGMNSEPKP L QL SPV Sbjct: 27 QCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72 >gb|KHG28073.1| Mitochondrial import receptor subunit TOM7-1 -like protein [Gossypium arboreum] Length = 72 Score = 87.8 bits (216), Expect = 4e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 +C+KEW+TWAMKKAKVVTHYGFIPL+I+IGMNSEPKP L QL SPV Sbjct: 27 QCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72 >ref|XP_009406780.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] Length = 72 Score = 87.4 bits (215), Expect = 5e-15 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 KC KEW+TWAMKKAKV+THYGFIPLII IGMNSEPKP L QL SPV Sbjct: 27 KCFKEWSTWAMKKAKVITHYGFIPLIITIGMNSEPKPQLYQLLSPV 72 >ref|XP_011623506.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Amborella trichopoda] Length = 71 Score = 86.7 bits (213), Expect = 8e-15 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSP 258 KCVKEW+TW +KKAKVV HYGFIPLIIVIGMNSEPKP LSQL SP Sbjct: 26 KCVKEWSTWTLKKAKVVAHYGFIPLIIVIGMNSEPKPYLSQLVSP 70 >ref|XP_011077684.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 86.7 bits (213), Expect = 8e-15 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 K VKEW+TW MKKAKV+THYGFIP++I+IGMNSEPKP+LSQL SPV Sbjct: 33 KFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQLLSPV 78 >ref|XP_011077105.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 86.7 bits (213), Expect = 8e-15 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 K VKEW+TW MKKAKV+THYGFIP++I+IGMNSEPKP+LSQL SPV Sbjct: 33 KFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQLLSPV 78 >ref|XP_010263429.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Nelumbo nucifera] Length = 89 Score = 86.7 bits (213), Expect = 8e-15 Identities = 35/45 (77%), Positives = 43/45 (95%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSP 258 KC+K+W+TW MKKAKV+THYGFIPL+I+IG+NSEPKPTLSQL +P Sbjct: 44 KCLKDWSTWTMKKAKVITHYGFIPLVIIIGVNSEPKPTLSQLLTP 88 >ref|XP_010046892.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Eucalyptus grandis] Length = 84 Score = 86.7 bits (213), Expect = 8e-15 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 + +KEW+TWAMKKAKV+THYGFIPL+I+IGMNSEPKP LSQL SPV Sbjct: 39 QAIKEWSTWAMKKAKVITHYGFIPLVIIIGMNSEPKPHLSQLLSPV 84 >ref|XP_007160221.1| hypothetical protein PHAVU_002G303100g [Phaseolus vulgaris] gi|561033636|gb|ESW32215.1| hypothetical protein PHAVU_002G303100g [Phaseolus vulgaris] Length = 72 Score = 86.7 bits (213), Expect = 8e-15 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -2 Query: 395 NKCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 ++ +KEWTTW M+KAKV+THYGFIPL+I+IGMNS+PKP LSQLFSPV Sbjct: 26 SESLKEWTTWTMRKAKVITHYGFIPLVIIIGMNSDPKPALSQLFSPV 72 >ref|XP_009362070.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Pyrus x bretschneideri] Length = 73 Score = 86.3 bits (212), Expect = 1e-14 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 386 VKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 VKEW+TWAMKKAKVVTHYGFIPL+I+IGMNS+PKP LSQL SPV Sbjct: 30 VKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSDPKPQLSQLLSPV 73 >ref|XP_012850170.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Erythranthe guttatus] gi|604313221|gb|EYU26552.1| hypothetical protein MIMGU_mgv1a017391mg [Erythranthe guttata] Length = 78 Score = 86.3 bits (212), Expect = 1e-14 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -2 Query: 392 KCVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 K VKEW+TW MKKAKV+THYGFIPL+I+IGMNS+PKP+LSQL SPV Sbjct: 33 KFVKEWSTWTMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 78 >ref|XP_006473187.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Citrus sinensis] gi|641865215|gb|KDO83900.1| hypothetical protein CISIN_1g035165mg [Citrus sinensis] gi|641865216|gb|KDO83901.1| hypothetical protein CISIN_1g035165mg [Citrus sinensis] Length = 71 Score = 86.3 bits (212), Expect = 1e-14 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -2 Query: 389 CVKEWTTWAMKKAKVVTHYGFIPLIIVIGMNSEPKPTLSQLFSPV 255 C+KEW+TWAMKKAKV+THYGFIPL+I+IGMNS+PKP L QL SPV Sbjct: 27 CLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLHQLLSPV 71