BLASTX nr result
ID: Anemarrhena21_contig00013056
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00013056 (450 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010551921.1| PREDICTED: 54S ribosomal protein L37, mitoch... 117 3e-24 ref|XP_009605816.1| PREDICTED: 54S ribosomal protein L37, mitoch... 116 7e-24 gb|KHG03339.1| 54S ribosomal L37, mitochondrial [Gossypium arbor... 115 1e-23 ref|XP_009800845.1| PREDICTED: 54S ribosomal protein L37, mitoch... 115 1e-23 gb|KJB74600.1| hypothetical protein B456_012G089400 [Gossypium r... 114 2e-23 ref|XP_012458699.1| PREDICTED: 54S ribosomal protein L37, mitoch... 114 2e-23 ref|XP_012458700.1| PREDICTED: 54S ribosomal protein L37, mitoch... 114 2e-23 ref|XP_010271329.1| PREDICTED: 54S ribosomal protein L37, mitoch... 114 2e-23 ref|XP_007031750.1| Mitochondrial ribosomal protein L37 isoform ... 114 2e-23 ref|XP_004302085.1| PREDICTED: 54S ribosomal protein L37, mitoch... 114 3e-23 gb|KJB70838.1| hypothetical protein B456_011G092800 [Gossypium r... 113 4e-23 ref|XP_012457195.1| PREDICTED: 39S ribosomal protein L54, mitoch... 113 4e-23 ref|XP_011097320.1| PREDICTED: 54S ribosomal protein L37, mitoch... 113 4e-23 ref|XP_003620189.1| hypothetical protein MTR_6g078300 [Medicago ... 113 6e-23 ref|XP_010931910.1| PREDICTED: 54S ribosomal protein L37, mitoch... 112 7e-23 ref|XP_007154682.1| hypothetical protein PHAVU_003G138900g [Phas... 112 7e-23 ref|XP_004250113.1| PREDICTED: 54S ribosomal protein L37, mitoch... 112 7e-23 gb|KHG00446.1| 54S ribosomal L37, mitochondrial [Gossypium arbor... 112 1e-22 ref|XP_012840721.1| PREDICTED: 54S ribosomal protein L37, mitoch... 111 2e-22 ref|XP_006299087.1| hypothetical protein CARUB_v10015225mg [Caps... 110 3e-22 >ref|XP_010551921.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X1 [Tarenaya hassleriana] gi|729390048|ref|XP_010551922.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X2 [Tarenaya hassleriana] Length = 130 Score = 117 bits (293), Expect = 3e-24 Identities = 56/64 (87%), Positives = 58/64 (90%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPKIL DSEYPD +WHLLDK PALSELRRKD ETLPYDDLKRFVKLD RARIKENN+V Sbjct: 67 GADPKILPDSEYPDWLWHLLDKHPALSELRRKDVETLPYDDLKRFVKLDTRARIKENNSV 126 Query: 268 RAKN 257 RAKN Sbjct: 127 RAKN 130 >ref|XP_009605816.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Nicotiana tomentosiformis] gi|697104020|ref|XP_009605817.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Nicotiana tomentosiformis] gi|697104022|ref|XP_009605818.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Nicotiana tomentosiformis] Length = 132 Score = 116 bits (290), Expect = 7e-24 Identities = 54/64 (84%), Positives = 59/64 (92%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPK+LADSEYPD +WHLLDK PALSELRRKD E+LPYDDLKRFVKLD RARIKENN++ Sbjct: 69 GADPKVLADSEYPDWLWHLLDKRPALSELRRKDLESLPYDDLKRFVKLDTRARIKENNSI 128 Query: 268 RAKN 257 RAKN Sbjct: 129 RAKN 132 >gb|KHG03339.1| 54S ribosomal L37, mitochondrial [Gossypium arboreum] Length = 131 Score = 115 bits (287), Expect = 1e-23 Identities = 53/64 (82%), Positives = 60/64 (93%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 GTDPKI+ DSEYPD +WHLLDK PALSELRRK+ ETLPY+DLKRFVKLDNRARIKENN++ Sbjct: 68 GTDPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNRARIKENNSI 127 Query: 268 RAKN 257 +AKN Sbjct: 128 KAKN 131 >ref|XP_009800845.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Nicotiana sylvestris] Length = 132 Score = 115 bits (287), Expect = 1e-23 Identities = 53/64 (82%), Positives = 59/64 (92%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPK+LADSEYPD +WHLLDK PALSELRRKD E+LPYDDLKRFVKLD RARIKENN++ Sbjct: 69 GADPKVLADSEYPDWLWHLLDKRPALSELRRKDLESLPYDDLKRFVKLDTRARIKENNSI 128 Query: 268 RAKN 257 +AKN Sbjct: 129 KAKN 132 >gb|KJB74600.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 126 Score = 114 bits (286), Expect = 2e-23 Identities = 54/64 (84%), Positives = 58/64 (90%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPKI DSEYPD +WHLLDK PALSELRRKD ETLPY+DLKRFVKLDNRARIKENN+V Sbjct: 63 GADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYEDLKRFVKLDNRARIKENNSV 122 Query: 268 RAKN 257 +AKN Sbjct: 123 KAKN 126 >ref|XP_012458699.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X1 [Gossypium raimondii] gi|763807697|gb|KJB74599.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 144 Score = 114 bits (286), Expect = 2e-23 Identities = 54/64 (84%), Positives = 58/64 (90%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPKI DSEYPD +WHLLDK PALSELRRKD ETLPY+DLKRFVKLDNRARIKENN+V Sbjct: 81 GADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYEDLKRFVKLDNRARIKENNSV 140 Query: 268 RAKN 257 +AKN Sbjct: 141 KAKN 144 >ref|XP_012458700.1| PREDICTED: 54S ribosomal protein L37, mitochondrial isoform X2 [Gossypium raimondii] gi|763807696|gb|KJB74598.1| hypothetical protein B456_012G089400 [Gossypium raimondii] Length = 131 Score = 114 bits (286), Expect = 2e-23 Identities = 54/64 (84%), Positives = 58/64 (90%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPKI DSEYPD +WHLLDK PALSELRRKD ETLPY+DLKRFVKLDNRARIKENN+V Sbjct: 68 GADPKIFLDSEYPDWLWHLLDKRPALSELRRKDIETLPYEDLKRFVKLDNRARIKENNSV 127 Query: 268 RAKN 257 +AKN Sbjct: 128 KAKN 131 >ref|XP_010271329.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Nelumbo nucifera] Length = 132 Score = 114 bits (286), Expect = 2e-23 Identities = 54/64 (84%), Positives = 58/64 (90%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPKIL DSEYPD +WHLLDK PALSELRRK+ ETLPYD+LKRFVKLDNRARIKENN + Sbjct: 69 GADPKILPDSEYPDWLWHLLDKKPALSELRRKNIETLPYDELKRFVKLDNRARIKENNVI 128 Query: 268 RAKN 257 RAKN Sbjct: 129 RAKN 132 >ref|XP_007031750.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646903|ref|XP_007031751.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646906|ref|XP_007031752.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646909|ref|XP_007031753.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|590646912|ref|XP_007031754.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710779|gb|EOY02676.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710780|gb|EOY02677.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710781|gb|EOY02678.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710782|gb|EOY02679.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] gi|508710783|gb|EOY02680.1| Mitochondrial ribosomal protein L37 isoform 1 [Theobroma cacao] Length = 131 Score = 114 bits (286), Expect = 2e-23 Identities = 54/64 (84%), Positives = 59/64 (92%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPKI+ DSEYPD +WHLLDK PALSELRRK+ ETLPY+DLKRFVKLDNRARIKENNAV Sbjct: 68 GADPKIMPDSEYPDWLWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNRARIKENNAV 127 Query: 268 RAKN 257 +AKN Sbjct: 128 KAKN 131 >ref|XP_004302085.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 133 Score = 114 bits (285), Expect = 3e-23 Identities = 53/64 (82%), Positives = 60/64 (93%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 GTDPKIL DSEYP+ +WHL+DK PALSELRRKD ETLPY+DLKRFVKLDNRARIKENN++ Sbjct: 70 GTDPKILPDSEYPEWLWHLVDKRPALSELRRKDIETLPYEDLKRFVKLDNRARIKENNSL 129 Query: 268 RAKN 257 +AKN Sbjct: 130 KAKN 133 >gb|KJB70838.1| hypothetical protein B456_011G092800 [Gossypium raimondii] Length = 147 Score = 113 bits (283), Expect = 4e-23 Identities = 53/64 (82%), Positives = 59/64 (92%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 GTDPKI+ DSEYPD VWHLLDK PALSELRRK+ ETLPY+DLKRFVKLDNRA IKENN++ Sbjct: 84 GTDPKIMPDSEYPDWVWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNRALIKENNSI 143 Query: 268 RAKN 257 +AKN Sbjct: 144 KAKN 147 >ref|XP_012457195.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium raimondii] gi|823249089|ref|XP_012457196.1| PREDICTED: 39S ribosomal protein L54, mitochondrial-like [Gossypium raimondii] gi|763803899|gb|KJB70837.1| hypothetical protein B456_011G092800 [Gossypium raimondii] gi|763803901|gb|KJB70839.1| hypothetical protein B456_011G092800 [Gossypium raimondii] Length = 131 Score = 113 bits (283), Expect = 4e-23 Identities = 53/64 (82%), Positives = 59/64 (92%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 GTDPKI+ DSEYPD VWHLLDK PALSELRRK+ ETLPY+DLKRFVKLDNRA IKENN++ Sbjct: 68 GTDPKIMPDSEYPDWVWHLLDKRPALSELRRKNIETLPYEDLKRFVKLDNRALIKENNSI 127 Query: 268 RAKN 257 +AKN Sbjct: 128 KAKN 131 >ref|XP_011097320.1| PREDICTED: 54S ribosomal protein L37, mitochondrial [Sesamum indicum] Length = 132 Score = 113 bits (283), Expect = 4e-23 Identities = 53/64 (82%), Positives = 59/64 (92%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPKIL DSEYPD +WHLLDK PALSELRRKD E+LPY+DLKRFVKLDNRARIKENN++ Sbjct: 69 GQDPKILPDSEYPDWLWHLLDKRPALSELRRKDVESLPYEDLKRFVKLDNRARIKENNSL 128 Query: 268 RAKN 257 +AKN Sbjct: 129 KAKN 132 >ref|XP_003620189.1| hypothetical protein MTR_6g078300 [Medicago truncatula] gi|217069986|gb|ACJ83353.1| unknown [Medicago truncatula] gi|355495204|gb|AES76407.1| ribosomal protein L37 [Medicago truncatula] gi|388518995|gb|AFK47559.1| unknown [Medicago truncatula] Length = 131 Score = 113 bits (282), Expect = 6e-23 Identities = 52/64 (81%), Positives = 60/64 (93%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 GTDPKIL DSEYPD +WHLLDK PALSELRRK+ +TLPY+DLKR+VKLDNRARIKENN++ Sbjct: 68 GTDPKILPDSEYPDWLWHLLDKRPALSELRRKEIDTLPYEDLKRYVKLDNRARIKENNSL 127 Query: 268 RAKN 257 +AKN Sbjct: 128 KAKN 131 >ref|XP_010931910.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Elaeis guineensis] gi|743820947|ref|XP_010931911.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Elaeis guineensis] Length = 133 Score = 112 bits (281), Expect = 7e-23 Identities = 53/64 (82%), Positives = 58/64 (90%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPKI+ DS+YPD +WHLLDK P LSELRRKDTETL +DDLKRFVKLDNRARIKENNA+ Sbjct: 70 GADPKIMPDSDYPDWLWHLLDKRPPLSELRRKDTETLSFDDLKRFVKLDNRARIKENNAL 129 Query: 268 RAKN 257 RAKN Sbjct: 130 RAKN 133 >ref|XP_007154682.1| hypothetical protein PHAVU_003G138900g [Phaseolus vulgaris] gi|593783285|ref|XP_007154683.1| hypothetical protein PHAVU_003G138900g [Phaseolus vulgaris] gi|561028036|gb|ESW26676.1| hypothetical protein PHAVU_003G138900g [Phaseolus vulgaris] gi|561028037|gb|ESW26677.1| hypothetical protein PHAVU_003G138900g [Phaseolus vulgaris] Length = 131 Score = 112 bits (281), Expect = 7e-23 Identities = 53/64 (82%), Positives = 59/64 (92%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 GTDPKIL DS+YPDR+WHLLDK PALSELRR + ETL YD+LKRFVKLDNRARIKENN+V Sbjct: 68 GTDPKILLDSDYPDRLWHLLDKRPALSELRRNNIETLAYDNLKRFVKLDNRARIKENNSV 127 Query: 268 RAKN 257 +AKN Sbjct: 128 KAKN 131 >ref|XP_004250113.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Solanum lycopersicum] Length = 130 Score = 112 bits (281), Expect = 7e-23 Identities = 53/64 (82%), Positives = 58/64 (90%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPK+L DSEYPD +WHLLDK PALSELRRK+ E+LPYDDLKRFVKLD RARIKENN+V Sbjct: 67 GADPKVLPDSEYPDWLWHLLDKRPALSELRRKNLESLPYDDLKRFVKLDTRARIKENNSV 126 Query: 268 RAKN 257 RAKN Sbjct: 127 RAKN 130 >gb|KHG00446.1| 54S ribosomal L37, mitochondrial [Gossypium arboreum] Length = 136 Score = 112 bits (279), Expect = 1e-22 Identities = 53/64 (82%), Positives = 57/64 (89%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPKI DSEYPD +W LLDK PALSELRRKD ETLPY+DLKRFVKLDNRARIKENN+V Sbjct: 73 GADPKIFPDSEYPDLLWRLLDKRPALSELRRKDIETLPYEDLKRFVKLDNRARIKENNSV 132 Query: 268 RAKN 257 +AKN Sbjct: 133 KAKN 136 >ref|XP_012840721.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Erythranthe guttatus] gi|848880691|ref|XP_012840722.1| PREDICTED: 54S ribosomal protein L37, mitochondrial-like [Erythranthe guttatus] gi|604329451|gb|EYU34782.1| hypothetical protein MIMGU_mgv1a016197mg [Erythranthe guttata] gi|604329452|gb|EYU34783.1| hypothetical protein MIMGU_mgv1a016197mg [Erythranthe guttata] Length = 131 Score = 111 bits (278), Expect = 2e-22 Identities = 52/64 (81%), Positives = 58/64 (90%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G DPKIL DSEYPD +WHLLDK P LSEL+RKD +TLPYDDLKRFVKLDNRARIKENN++ Sbjct: 68 GQDPKILPDSEYPDWLWHLLDKKPPLSELKRKDIKTLPYDDLKRFVKLDNRARIKENNSL 127 Query: 268 RAKN 257 +AKN Sbjct: 128 KAKN 131 >ref|XP_006299087.1| hypothetical protein CARUB_v10015225mg [Capsella rubella] gi|482567796|gb|EOA31985.1| hypothetical protein CARUB_v10015225mg [Capsella rubella] Length = 125 Score = 110 bits (276), Expect = 3e-22 Identities = 51/64 (79%), Positives = 59/64 (92%) Frame = -3 Query: 448 GTDPKILADSEYPDRVWHLLDKWPALSELRRKDTETLPYDDLKRFVKLDNRARIKENNAV 269 G+DPKIL DS+YPD +WHLLDK PALSELRRK+ ETLPYDDLKRFVKLD RA+IK+NN+V Sbjct: 62 GSDPKILPDSDYPDWLWHLLDKRPALSELRRKNVETLPYDDLKRFVKLDTRAKIKDNNSV 121 Query: 268 RAKN 257 +AKN Sbjct: 122 KAKN 125