BLASTX nr result
ID: Anemarrhena21_contig00012417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00012417 (211 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008795892.1| PREDICTED: CBS domain-containing protein CBS... 79 2e-12 ref|XP_010906562.1| PREDICTED: CBS domain-containing protein CBS... 77 6e-12 ref|XP_010906559.1| PREDICTED: CBS domain-containing protein CBS... 77 6e-12 ref|XP_008779985.1| PREDICTED: CBS domain-containing protein CBS... 76 8e-12 ref|XP_010928346.1| PREDICTED: CBS domain-containing protein CBS... 74 4e-11 gb|EMT13804.1| hypothetical protein F775_12425 [Aegilops tauschii] 74 5e-11 ref|XP_007042479.1| Cystathionine beta-synthase family protein [... 73 6e-11 ref|XP_010028423.1| PREDICTED: CBS domain-containing protein CBS... 73 8e-11 gb|KCW44698.1| hypothetical protein EUGRSUZ_L01765 [Eucalyptus g... 73 8e-11 ref|XP_012079277.1| PREDICTED: CBS domain-containing protein CBS... 72 1e-10 dbj|BAJ53196.1| JHL03K20.5 [Jatropha curcas] 72 1e-10 ref|XP_008456144.1| PREDICTED: CBS domain-containing protein CBS... 72 2e-10 emb|CBI21385.3| unnamed protein product [Vitis vinifera] 72 2e-10 ref|XP_002283079.1| PREDICTED: CBS domain-containing protein CBS... 72 2e-10 ref|XP_004140707.1| PREDICTED: CBS domain-containing protein CBS... 72 2e-10 emb|CAN64036.1| hypothetical protein VITISV_021555 [Vitis vinifera] 72 2e-10 ref|XP_009377754.1| PREDICTED: CBS domain-containing protein CBS... 71 3e-10 ref|XP_007047345.1| Cystathionine beta-synthase family protein i... 71 3e-10 ref|XP_007047342.1| Cystathionine beta-synthase family protein i... 71 3e-10 ref|XP_002964488.1| hypothetical protein SELMODRAFT_81478, parti... 70 4e-10 >ref|XP_008795892.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like isoform X1 [Phoenix dactylifera] Length = 240 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/45 (84%), Positives = 43/45 (95%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEKSSQ 77 RLLLETKYHRLPVVD+AGKL+G+ITRGNVVRAAL+IK A EK+SQ Sbjct: 195 RLLLETKYHRLPVVDSAGKLIGIITRGNVVRAALQIKHASEKNSQ 239 >ref|XP_010906562.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like isoform X2 [Elaeis guineensis] Length = 158 Score = 76.6 bits (187), Expect = 6e-12 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEKSSQ 77 RLLLETKYHR PVVD+AGKL+G+ITRGNVV AAL+IKRA EK+SQ Sbjct: 113 RLLLETKYHRFPVVDSAGKLIGIITRGNVVSAALQIKRASEKNSQ 157 >ref|XP_010906559.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like isoform X1 [Elaeis guineensis] gi|743872474|ref|XP_010906560.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like isoform X1 [Elaeis guineensis] Length = 237 Score = 76.6 bits (187), Expect = 6e-12 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEKSSQ 77 RLLLETKYHR PVVD+AGKL+G+ITRGNVV AAL+IKRA EK+SQ Sbjct: 192 RLLLETKYHRFPVVDSAGKLIGIITRGNVVSAALQIKRASEKNSQ 236 >ref|XP_008779985.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Phoenix dactylifera] Length = 90 Score = 76.3 bits (186), Expect = 8e-12 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEKSSQ 77 RLLLETKY RLP+VDNAGKLVG+ITRGNVVRAAL+IK A E++SQ Sbjct: 45 RLLLETKYRRLPIVDNAGKLVGIITRGNVVRAALQIKHASERNSQ 89 >ref|XP_010928346.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Elaeis guineensis] Length = 236 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEKSSQ 77 RLLLETKY RLPVVDNAGKLVG+ITRGNVVRAAL+IK EK+S+ Sbjct: 191 RLLLETKYRRLPVVDNAGKLVGIITRGNVVRAALQIKHDSEKNSR 235 >gb|EMT13804.1| hypothetical protein F775_12425 [Aegilops tauschii] Length = 157 Score = 73.6 bits (179), Expect = 5e-11 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIE 89 RLLLETKYHRLPVVD+AGKLVG+ITRGNVVRAALEIK+ E Sbjct: 115 RLLLETKYHRLPVVDSAGKLVGMITRGNVVRAALEIKKKAE 155 >ref|XP_007042479.1| Cystathionine beta-synthase family protein [Theobroma cacao] gi|508706414|gb|EOX98310.1| Cystathionine beta-synthase family protein [Theobroma cacao] Length = 230 Score = 73.2 bits (178), Expect = 6e-11 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEKSS 80 RLLLETKY RLPVVD GKLVG+ITRGNVVRAAL+IKRA E+SS Sbjct: 187 RLLLETKYRRLPVVDGDGKLVGIITRGNVVRAALQIKRASERSS 230 >ref|XP_010028423.1| PREDICTED: CBS domain-containing protein CBSX2, chloroplastic [Eucalyptus grandis] gi|629088918|gb|KCW55171.1| hypothetical protein EUGRSUZ_I01128 [Eucalyptus grandis] Length = 240 Score = 72.8 bits (177), Expect = 8e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEKSS 80 RLLLETKYHRLPVVD G+L+G+ITRGNVVRAAL+IKRA E SS Sbjct: 197 RLLLETKYHRLPVVDGNGQLIGIITRGNVVRAALQIKRANEHSS 240 >gb|KCW44698.1| hypothetical protein EUGRSUZ_L01765 [Eucalyptus grandis] Length = 389 Score = 72.8 bits (177), Expect = 8e-11 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEKSS 80 RLLLETKYHRLPVVD G+L+G+ITRGNVVRAAL+IKRA E SS Sbjct: 346 RLLLETKYHRLPVVDGNGQLIGIITRGNVVRAALQIKRANEHSS 389 >ref|XP_012079277.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic [Jatropha curcas] gi|643722092|gb|KDP31971.1| hypothetical protein JCGZ_12432 [Jatropha curcas] Length = 238 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIE 89 RLLLETKY RLPVVD+ GKLVG+ITRGNVVRAALEIKR+IE Sbjct: 195 RLLLETKYRRLPVVDSEGKLVGIITRGNVVRAALEIKRSIE 235 >dbj|BAJ53196.1| JHL03K20.5 [Jatropha curcas] Length = 236 Score = 72.4 bits (176), Expect = 1e-10 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIE 89 RLLLETKY RLPVVD+ GKLVG+ITRGNVVRAALEIKR+IE Sbjct: 193 RLLLETKYRRLPVVDSEGKLVGIITRGNVVRAALEIKRSIE 233 >ref|XP_008456144.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Cucumis melo] Length = 239 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEKSS 80 RLLLETKY RLPVVD GKLVG+ITRGNVVRAAL+IKRA E+S+ Sbjct: 196 RLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIKRAAERST 239 >emb|CBI21385.3| unnamed protein product [Vitis vinifera] Length = 172 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIE 89 RLLLETKY RLPVVD+ GKLVG+ITRGNVVRAAL+IKRA+E Sbjct: 130 RLLLETKYRRLPVVDSDGKLVGIITRGNVVRAALQIKRAVE 170 >ref|XP_002283079.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic [Vitis vinifera] Length = 246 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIE 89 RLLLETKY RLPVVD+ GKLVG+ITRGNVVRAAL+IKRA+E Sbjct: 204 RLLLETKYRRLPVVDSDGKLVGIITRGNVVRAALQIKRAVE 244 >ref|XP_004140707.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Cucumis sativus] gi|700202380|gb|KGN57513.1| hypothetical protein Csa_3G202220 [Cucumis sativus] Length = 239 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/44 (81%), Positives = 40/44 (90%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEKSS 80 RLLLETKY RLPVVD GKLVG+ITRGNVVRAAL+IKRA E+S+ Sbjct: 196 RLLLETKYRRLPVVDADGKLVGIITRGNVVRAALQIKRAAERST 239 >emb|CAN64036.1| hypothetical protein VITISV_021555 [Vitis vinifera] Length = 288 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIE 89 RLLLETKY RLPVVD+ GKLVG+ITRGNVVRAAL+IKRA+E Sbjct: 246 RLLLETKYRRLPVVDSDGKLVGIITRGNVVRAALQIKRAVE 286 >ref|XP_009377754.1| PREDICTED: CBS domain-containing protein CBSX2, chloroplastic-like [Pyrus x bretschneideri] gi|694315947|ref|XP_009377789.1| PREDICTED: CBS domain-containing protein CBSX2, chloroplastic-like [Pyrus x bretschneideri] Length = 230 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEK 86 RLLLETKY RLPVVD+ GKLVG+ITRGNVV+AAL+IKRA EK Sbjct: 189 RLLLETKYRRLPVVDSEGKLVGIITRGNVVKAALQIKRASEK 230 >ref|XP_007047345.1| Cystathionine beta-synthase family protein isoform 4 [Theobroma cacao] gi|508699606|gb|EOX91502.1| Cystathionine beta-synthase family protein isoform 4 [Theobroma cacao] Length = 230 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIE 89 RLLLETKY RLPVVD GKLVG+ITRGNVVRAAL+IKRAIE Sbjct: 187 RLLLETKYRRLPVVDVEGKLVGIITRGNVVRAALQIKRAIE 227 >ref|XP_007047342.1| Cystathionine beta-synthase family protein isoform 1 [Theobroma cacao] gi|508699603|gb|EOX91499.1| Cystathionine beta-synthase family protein isoform 1 [Theobroma cacao] Length = 241 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIE 89 RLLLETKY RLPVVD GKLVG+ITRGNVVRAAL+IKRAIE Sbjct: 198 RLLLETKYRRLPVVDVEGKLVGIITRGNVVRAALQIKRAIE 238 >ref|XP_002964488.1| hypothetical protein SELMODRAFT_81478, partial [Selaginella moellendorffii] gi|302820740|ref|XP_002992036.1| hypothetical protein SELMODRAFT_134636, partial [Selaginella moellendorffii] gi|300140158|gb|EFJ06885.1| hypothetical protein SELMODRAFT_134636, partial [Selaginella moellendorffii] gi|300168217|gb|EFJ34821.1| hypothetical protein SELMODRAFT_81478, partial [Selaginella moellendorffii] Length = 165 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -1 Query: 211 RLLLETKYHRLPVVDNAGKLVGLITRGNVVRAALEIKRAIEKSSQA 74 R+LL+TKY RLPVVD GKLVGLITRGNVVRAAL++KRA E+++ + Sbjct: 119 RILLDTKYRRLPVVDECGKLVGLITRGNVVRAALQVKRAAEENTSS 164