BLASTX nr result
ID: Anemarrhena21_contig00012372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00012372 (408 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB06854.1| hypothetical protein B456_001G165200 [Gossypium r... 68 3e-09 ref|YP_004222366.1| hypothetical protein BevumaM_p133 [Beta vulg... 64 5e-08 >gb|KJB06854.1| hypothetical protein B456_001G165200 [Gossypium raimondii] Length = 70 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/47 (74%), Positives = 38/47 (80%) Frame = +3 Query: 267 LEMN*LLQKKFFDVGKGLSCVSVTNGPFIYGRTTGIEPARGGFTIHC 407 L+ + LL +K F GLSCVSVTNGPFI GRTTGIEPARGGFTIHC Sbjct: 3 LKASRLLAEKCF---LGLSCVSVTNGPFIDGRTTGIEPARGGFTIHC 46 >ref|YP_004222366.1| hypothetical protein BevumaM_p133 [Beta vulgaris subsp. maritima] gi|346683239|ref|YP_004842171.1| hypothetical protein BemaM_p127 [Beta macrocarpa] gi|317905598|emb|CBX33217.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439881|emb|CBX33312.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148035|emb|CBJ20699.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500157|emb|CBX24976.1| hypothetical protein [Beta macrocarpa] gi|384977917|emb|CBL54141.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 125 Score = 63.5 bits (153), Expect = 5e-08 Identities = 33/45 (73%), Positives = 34/45 (75%) Frame = +3 Query: 273 MN*LLQKKFFDVGKGLSCVSVTNGPFIYGRTTGIEPARGGFTIHC 407 M LL+K F GL CV VTNGPFI GRTTGIEPARGGFTIHC Sbjct: 1 MTCLLKKCFL----GLLCVFVTNGPFIDGRTTGIEPARGGFTIHC 41