BLASTX nr result
ID: Anemarrhena21_contig00012239
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00012239 (302 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010920345.1| PREDICTED: cytochrome P450 734A6-like [Elaei... 61 3e-07 ref|XP_010910876.1| PREDICTED: cytochrome P450 734A1-like, parti... 56 8e-06 >ref|XP_010920345.1| PREDICTED: cytochrome P450 734A6-like [Elaeis guineensis] Length = 504 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -3 Query: 129 VWWKPKEIQKYFLDQGIRGPPFRPLIGSLGELARIYGSAQSSP 1 VWW P IQK+FLDQGIRGP ++PL G+L E+A+I+ + SP Sbjct: 26 VWWNPLRIQKHFLDQGIRGPGYKPLFGNLREIAQIHRQVKRSP 68 >ref|XP_010910876.1| PREDICTED: cytochrome P450 734A1-like, partial [Elaeis guineensis] Length = 222 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/43 (55%), Positives = 31/43 (72%) Frame = -3 Query: 129 VWWKPKEIQKYFLDQGIRGPPFRPLIGSLGELARIYGSAQSSP 1 VWW P IQK F DQGIRGP ++PL G+L E+A+I+ + SP Sbjct: 27 VWWNPLRIQKRFHDQGIRGPGYKPLFGNLMEIAQIHRQVKRSP 69