BLASTX nr result
ID: Anemarrhena21_contig00012031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00012031 (490 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010942409.1| PREDICTED: mitochondrial ubiquitin ligase ac... 94 4e-17 ref|XP_010942408.1| PREDICTED: mitochondrial ubiquitin ligase ac... 94 4e-17 ref|XP_008798861.1| PREDICTED: mitochondrial ubiquitin ligase ac... 94 4e-17 ref|XP_008798860.1| PREDICTED: mitochondrial ubiquitin ligase ac... 94 4e-17 gb|AIZ68184.1| mitochondrial ubiquitin ligase activator of NFKB ... 93 8e-17 ref|XP_010684326.1| PREDICTED: mitochondrial ubiquitin ligase ac... 92 1e-16 ref|XP_010684325.1| PREDICTED: mitochondrial ubiquitin ligase ac... 92 1e-16 ref|XP_010278994.1| PREDICTED: mitochondrial ubiquitin ligase ac... 92 1e-16 ref|XP_006850825.2| PREDICTED: mitochondrial ubiquitin ligase ac... 92 2e-16 ref|XP_011625708.1| PREDICTED: mitochondrial ubiquitin ligase ac... 92 2e-16 ref|NP_001131793.1| uncharacterized protein LOC100193166 precurs... 92 2e-16 ref|XP_006444143.1| hypothetical protein CICLE_v10020955mg [Citr... 92 2e-16 ref|XP_008650875.1| PREDICTED: uncharacterized protein LOC100193... 92 2e-16 tpg|DAA63924.1| TPA: hypothetical protein ZEAMMB73_046924 [Zea m... 92 2e-16 ref|XP_010255797.1| PREDICTED: mitochondrial ubiquitin ligase ac... 91 2e-16 ref|XP_012092300.1| PREDICTED: mitochondrial ubiquitin ligase ac... 91 2e-16 gb|EEC82565.1| hypothetical protein OsI_27112 [Oryza sativa Indi... 91 2e-16 ref|XP_006658048.1| PREDICTED: mitochondrial ubiquitin ligase ac... 91 2e-16 ref|XP_004958530.1| PREDICTED: mitochondrial ubiquitin ligase ac... 91 2e-16 ref|XP_008670617.1| PREDICTED: mitochondrial ubiquitin ligase ac... 91 2e-16 >ref|XP_010942409.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X2 [Elaeis guineensis] Length = 341 Score = 94.0 bits (232), Expect = 4e-17 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCCT+CSSHLTNCPLCRRRIDQVV+TFRH Sbjct: 302 YNAVFVPCGHMCCCTTCSSHLTNCPLCRRRIDQVVKTFRH 341 >ref|XP_010942408.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X1 [Elaeis guineensis] Length = 343 Score = 94.0 bits (232), Expect = 4e-17 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCCT+CSSHLTNCPLCRRRIDQVV+TFRH Sbjct: 304 YNAVFVPCGHMCCCTTCSSHLTNCPLCRRRIDQVVKTFRH 343 >ref|XP_008798861.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X2 [Phoenix dactylifera] Length = 341 Score = 94.0 bits (232), Expect = 4e-17 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCCT+CSSHLTNCPLCRRRIDQVV+TFRH Sbjct: 302 YNAVFVPCGHMCCCTTCSSHLTNCPLCRRRIDQVVKTFRH 341 >ref|XP_008798860.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X1 [Phoenix dactylifera] Length = 343 Score = 94.0 bits (232), Expect = 4e-17 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCCT+CSSHLTNCPLCRRRIDQVV+TFRH Sbjct: 304 YNAVFVPCGHMCCCTTCSSHLTNCPLCRRRIDQVVKTFRH 343 >gb|AIZ68184.1| mitochondrial ubiquitin ligase activator of NFKB 1 isoform X2 [Ornithogalum longebracteatum] Length = 344 Score = 92.8 bits (229), Expect = 8e-17 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCCTSCSSHLT CPLCRRRIDQVVRTFRH Sbjct: 305 YNAVFVPCGHMCCCTSCSSHLTICPLCRRRIDQVVRTFRH 344 >ref|XP_010684326.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X2 [Beta vulgaris subsp. vulgaris] Length = 338 Score = 92.0 bits (227), Expect = 1e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCCT+CSSHL+NCPLCRRRI+QVVRTFRH Sbjct: 299 YNAVFVPCGHMCCCTACSSHLSNCPLCRRRIEQVVRTFRH 338 >ref|XP_010684325.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X1 [Beta vulgaris subsp. vulgaris] gi|870854316|gb|KMT06107.1| hypothetical protein BVRB_7g163340 [Beta vulgaris subsp. vulgaris] Length = 339 Score = 92.0 bits (227), Expect = 1e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCCT+CSSHL+NCPLCRRRI+QVVRTFRH Sbjct: 300 YNAVFVPCGHMCCCTACSSHLSNCPLCRRRIEQVVRTFRH 339 >ref|XP_010278994.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like isoform X1 [Nelumbo nucifera] gi|719972947|ref|XP_010279001.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1-like isoform X1 [Nelumbo nucifera] Length = 332 Score = 92.0 bits (227), Expect = 1e-16 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCCTSC SHLTNCPLCRRRI+Q+VRTFRH Sbjct: 293 YNAVFVPCGHMCCCTSCFSHLTNCPLCRRRIEQIVRTFRH 332 >ref|XP_006850825.2| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 isoform X3 [Amborella trichopoda] Length = 343 Score = 91.7 bits (226), Expect = 2e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCCTSCSSHLT+CPLCRRRI+QVV+TFRH Sbjct: 304 YNAVFVPCGHMCCCTSCSSHLTSCPLCRRRIEQVVKTFRH 343 >ref|XP_011625708.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X1 [Amborella trichopoda] gi|769804090|ref|XP_011625709.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 isoform X2 [Amborella trichopoda] Length = 344 Score = 91.7 bits (226), Expect = 2e-16 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCCTSCSSHLT+CPLCRRRI+QVV+TFRH Sbjct: 305 YNAVFVPCGHMCCCTSCSSHLTSCPLCRRRIEQVVKTFRH 344 >ref|NP_001131793.1| uncharacterized protein LOC100193166 precursor [Zea mays] gi|194692560|gb|ACF80364.1| unknown [Zea mays] gi|414887914|tpg|DAA63928.1| TPA: hypothetical protein ZEAMMB73_046924 [Zea mays] Length = 331 Score = 91.7 bits (226), Expect = 2e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCC +CSSHLTNCPLCRRRIDQ VRTFRH Sbjct: 292 YNAVFVPCGHMCCCVACSSHLTNCPLCRRRIDQAVRTFRH 331 >ref|XP_006444143.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|567903312|ref|XP_006444144.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|568852219|ref|XP_006479777.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-A-like [Citrus sinensis] gi|557546405|gb|ESR57383.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] gi|557546406|gb|ESR57384.1| hypothetical protein CICLE_v10020955mg [Citrus clementina] Length = 344 Score = 91.7 bits (226), Expect = 2e-16 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCC CSSHLTNCPLCRRRIDQVVRTFRH Sbjct: 305 YNAVFVPCGHMCCCIICSSHLTNCPLCRRRIDQVVRTFRH 344 >ref|XP_008650875.1| PREDICTED: uncharacterized protein LOC100193166 isoform X1 [Zea mays] gi|414887915|tpg|DAA63929.1| TPA: hypothetical protein ZEAMMB73_046924 [Zea mays] Length = 343 Score = 91.7 bits (226), Expect = 2e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCC +CSSHLTNCPLCRRRIDQ VRTFRH Sbjct: 304 YNAVFVPCGHMCCCVACSSHLTNCPLCRRRIDQAVRTFRH 343 >tpg|DAA63924.1| TPA: hypothetical protein ZEAMMB73_046924 [Zea mays] Length = 180 Score = 91.7 bits (226), Expect = 2e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCC +CSSHLTNCPLCRRRIDQ VRTFRH Sbjct: 141 YNAVFVPCGHMCCCVACSSHLTNCPLCRRRIDQAVRTFRH 180 >ref|XP_010255797.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Nelumbo nucifera] Length = 343 Score = 91.3 bits (225), Expect = 2e-16 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCCT+CSSHLT+CPLCRRRI+Q+VRTFRH Sbjct: 304 YNAVFVPCGHMCCCTTCSSHLTSCPLCRRRIEQIVRTFRH 343 >ref|XP_012092300.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Jatropha curcas] gi|643704443|gb|KDP21507.1| hypothetical protein JCGZ_21978 [Jatropha curcas] Length = 344 Score = 91.3 bits (225), Expect = 2e-16 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVF+PCGHMCCCT+CSSHLTNCPLCRRRI+QVV+TFRH Sbjct: 305 YNAVFLPCGHMCCCTACSSHLTNCPLCRRRIEQVVKTFRH 344 >gb|EEC82565.1| hypothetical protein OsI_27112 [Oryza sativa Indica Group] gi|222637570|gb|EEE67702.1| hypothetical protein OsJ_25368 [Oryza sativa Japonica Group] Length = 343 Score = 91.3 bits (225), Expect = 2e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCC +CSSHLTNCPLCRRRIDQ VRTFRH Sbjct: 304 YNAVFVPCGHMCCCMNCSSHLTNCPLCRRRIDQAVRTFRH 343 >ref|XP_006658048.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Oryza brachyantha] Length = 343 Score = 91.3 bits (225), Expect = 2e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCC +CSSHLTNCPLCRRRIDQ VRTFRH Sbjct: 304 YNAVFVPCGHMCCCMNCSSHLTNCPLCRRRIDQAVRTFRH 343 >ref|XP_004958530.1| PREDICTED: mitochondrial ubiquitin ligase activator of NFKB 1 [Setaria italica] Length = 343 Score = 91.3 bits (225), Expect = 2e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCC +CSSHLTNCPLCRRRIDQ VRTFRH Sbjct: 304 YNAVFVPCGHMCCCMACSSHLTNCPLCRRRIDQAVRTFRH 343 >ref|XP_008670617.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like isoform X1 [Zea mays] gi|414591053|tpg|DAA41624.1| TPA: hypothetical protein ZEAMMB73_684695 [Zea mays] Length = 343 Score = 91.3 bits (225), Expect = 2e-16 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -2 Query: 489 YNAVFVPCGHMCCCTSCSSHLTNCPLCRRRIDQVVRTFRH 370 YNAVFVPCGHMCCC +CSSHLTNCPLCRRRIDQ VRTFRH Sbjct: 304 YNAVFVPCGHMCCCMACSSHLTNCPLCRRRIDQAVRTFRH 343