BLASTX nr result
ID: Anemarrhena21_contig00011669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00011669 (294 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009409398.1| PREDICTED: heavy metal-associated isoprenyla... 65 2e-08 ref|XP_008812071.1| PREDICTED: heavy metal-associated isoprenyla... 64 3e-08 ref|XP_010925640.1| PREDICTED: heavy metal-associated isoprenyla... 64 5e-08 ref|XP_010915521.1| PREDICTED: heavy metal-associated isoprenyla... 60 4e-07 ref|XP_009380948.1| PREDICTED: heavy metal-associated isoprenyla... 59 1e-06 ref|XP_009404504.1| PREDICTED: copper transport protein CCH-like... 58 2e-06 ref|XP_011008470.1| PREDICTED: heavy metal-associated isoprenyla... 57 4e-06 ref|XP_002305747.2| hypothetical protein POPTR_0004s05570g [Popu... 57 4e-06 ref|XP_006377550.1| hypothetical protein POPTR_0011s07430g [Popu... 57 4e-06 ref|XP_002317426.2| hypothetical protein POPTR_0011s07430g [Popu... 57 4e-06 ref|XP_010277036.1| PREDICTED: heavy metal-associated isoprenyla... 57 6e-06 ref|XP_010277035.1| PREDICTED: heavy metal-associated isoprenyla... 57 6e-06 >ref|XP_009409398.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Musa acuminata subsp. malaccensis] Length = 147 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/42 (71%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = -1 Query: 228 KHGYDDSCMQYGYYQRPSYS-TVDDKARALFSDDNPNACSIM 106 KHGYDDS M +GYYQRP +S +D+KAR +FSDDNPNACS+M Sbjct: 107 KHGYDDSSM-HGYYQRPPHSHIIDEKARMMFSDDNPNACSVM 147 >ref|XP_008812071.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Phoenix dactylifera] Length = 146 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/43 (69%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -1 Query: 231 HKHGYDDSCMQYGYYQRPSYS-TVDDKARALFSDDNPNACSIM 106 +KHGY+DS M +GYYQ P+YS VD++AR++FSDDNPNACSIM Sbjct: 105 YKHGYNDSDM-HGYYQNPTYSHIVDERARSIFSDDNPNACSIM 146 >ref|XP_010925640.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Elaeis guineensis] Length = 146 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/43 (69%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -1 Query: 231 HKHGYDDSCMQYGYYQRPSYS-TVDDKARALFSDDNPNACSIM 106 +KHGY+DS +GYYQ+P+YS VD++AR+LFSDDNPNACSIM Sbjct: 105 YKHGYNDSDT-HGYYQKPTYSHIVDERARSLFSDDNPNACSIM 146 >ref|XP_010915521.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Elaeis guineensis] Length = 146 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/43 (65%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = -1 Query: 231 HKHGYDDSCMQYGYYQRPSYS-TVDDKARALFSDDNPNACSIM 106 ++HGY+DS M +GYYQ+P+ S VD++AR++FSDDNPNACSIM Sbjct: 105 YRHGYNDSDM-HGYYQKPTSSHIVDERARSIFSDDNPNACSIM 146 >ref|XP_009380948.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Musa acuminata subsp. malaccensis] Length = 146 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/43 (60%), Positives = 37/43 (86%), Gaps = 1/43 (2%) Frame = -1 Query: 231 HKHGYDDSCMQYGYYQRPSYS-TVDDKARALFSDDNPNACSIM 106 +KHGYDDS + +GYYQ+P+++ ++++AR FSDDNPNACSIM Sbjct: 105 YKHGYDDSTL-HGYYQQPAHTHIIEEEARVRFSDDNPNACSIM 146 >ref|XP_009404504.1| PREDICTED: copper transport protein CCH-like [Musa acuminata subsp. malaccensis] Length = 146 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -1 Query: 231 HKHGYDDSCMQYGYYQRPSYS-TVDDKARALFSDDNPNACSIM 106 HKHGYDDS + +GYYQ P+ + + D ARA FSDDNP ACS+M Sbjct: 105 HKHGYDDSSL-HGYYQEPAQTHIIGDDARARFSDDNPTACSVM 146 >ref|XP_011008470.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Populus euphratica] Length = 146 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/42 (59%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = -1 Query: 228 KHGYDDSCMQYGYYQRPSYST-VDDKARALFSDDNPNACSIM 106 KHGY++ ++GYYQ+P+Y+T VD++A A+FSD+NP+ACSIM Sbjct: 107 KHGYNEQ--EFGYYQKPAYATIVDEEASAIFSDENPHACSIM 146 >ref|XP_002305747.2| hypothetical protein POPTR_0004s05570g [Populus trichocarpa] gi|550340396|gb|EEE86258.2| hypothetical protein POPTR_0004s05570g [Populus trichocarpa] Length = 151 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/42 (59%), Positives = 37/42 (88%), Gaps = 1/42 (2%) Frame = -1 Query: 228 KHGYDDSCMQYGYYQRPSYST-VDDKARALFSDDNPNACSIM 106 KHGY++ ++GYYQ+P+Y+T VD++A A+FSD+NP+ACSIM Sbjct: 112 KHGYNEE--EFGYYQKPAYATIVDEEASAIFSDENPHACSIM 151 >ref|XP_006377550.1| hypothetical protein POPTR_0011s07430g [Populus trichocarpa] gi|550327869|gb|ERP55347.1| hypothetical protein POPTR_0011s07430g [Populus trichocarpa] Length = 142 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/43 (58%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 231 HKHGYDDSCMQYGYYQRPSYSTV-DDKARALFSDDNPNACSIM 106 HKHGY+D ++G YQ+P Y+T+ D++A A+FSD+NP+ACSIM Sbjct: 102 HKHGYNDE--EFGRYQKPPYATIFDEEASAMFSDENPHACSIM 142 >ref|XP_002317426.2| hypothetical protein POPTR_0011s07430g [Populus trichocarpa] gi|550327868|gb|EEE98038.2| hypothetical protein POPTR_0011s07430g [Populus trichocarpa] Length = 147 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/43 (58%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 231 HKHGYDDSCMQYGYYQRPSYSTV-DDKARALFSDDNPNACSIM 106 HKHGY+D ++G YQ+P Y+T+ D++A A+FSD+NP+ACSIM Sbjct: 107 HKHGYNDE--EFGRYQKPPYATIFDEEASAMFSDENPHACSIM 147 >ref|XP_010277036.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like isoform X2 [Nelumbo nucifera] Length = 154 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -1 Query: 228 KHGYDDSCMQYGYYQRPSYSTV-DDKARALFSDDNPNACSIM 106 KHGYD +GYYQ P YST+ D++ A+FSDDNPNACSIM Sbjct: 115 KHGYDGH--DHGYYQPPPYSTIFDERTGAVFSDDNPNACSIM 154 >ref|XP_010277035.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like isoform X1 [Nelumbo nucifera] Length = 200 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -1 Query: 228 KHGYDDSCMQYGYYQRPSYSTV-DDKARALFSDDNPNACSIM 106 KHGYD +GYYQ P YST+ D++ A+FSDDNPNACSIM Sbjct: 161 KHGYDGH--DHGYYQPPPYSTIFDERTGAVFSDDNPNACSIM 200