BLASTX nr result
ID: Anemarrhena21_contig00011467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00011467 (307 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008804847.1| PREDICTED: probable calcium-binding protein ... 131 2e-28 ref|XP_010906963.1| PREDICTED: probable calcium-binding protein ... 130 3e-28 ref|XP_009393387.1| PREDICTED: probable calcium-binding protein ... 124 2e-26 ref|XP_002275521.1| PREDICTED: probable calcium-binding protein ... 122 7e-26 emb|CAN80623.1| hypothetical protein VITISV_043433 [Vitis vinifera] 122 7e-26 ref|XP_012076123.1| PREDICTED: probable calcium-binding protein ... 120 4e-25 gb|KJB21714.1| hypothetical protein B456_004G009900 [Gossypium r... 119 1e-24 ref|XP_012472852.1| PREDICTED: probable calcium-binding protein ... 119 1e-24 gb|KHG08019.1| putative calcium-binding CML48 -like protein [Gos... 119 1e-24 ref|XP_010271645.1| PREDICTED: probable calcium-binding protein ... 119 1e-24 ref|XP_007015806.1| Calcium-binding EF-hand family protein [Theo... 118 1e-24 ref|XP_011043032.1| PREDICTED: probable calcium-binding protein ... 117 4e-24 ref|XP_002313594.1| hypothetical protein POPTR_0009s16510g [Popu... 117 4e-24 ref|XP_004139489.1| PREDICTED: probable calcium-binding protein ... 116 7e-24 gb|KDO58092.1| hypothetical protein CISIN_1g025714mg [Citrus sin... 115 9e-24 gb|KDO58091.1| hypothetical protein CISIN_1g025714mg [Citrus sin... 115 9e-24 ref|XP_002523826.1| ef-hand calcium binding protein, putative [R... 115 9e-24 ref|XP_006487936.1| PREDICTED: probable calcium-binding protein ... 115 9e-24 ref|XP_006424234.1| hypothetical protein CICLE_v10029136mg [Citr... 115 9e-24 ref|XP_006424233.1| hypothetical protein CICLE_v10029136mg [Citr... 115 9e-24 >ref|XP_008804847.1| PREDICTED: probable calcium-binding protein CML48 [Phoenix dactylifera] Length = 244 Score = 131 bits (329), Expect = 2e-28 Identities = 61/77 (79%), Positives = 68/77 (88%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T PEI+RSFQAVDRDRSG IDE+ELQ ALSSGY +FS +TIRLLMFLF NP NPSK+GP Sbjct: 73 THPEIIRSFQAVDRDRSGFIDEYELQAALSSGYHRFSLRTIRLLMFLFKNPNNPSKMGPA 132 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW CLG+WRAIF+ Sbjct: 133 EFAALWSCLGQWRAIFD 149 >ref|XP_010906963.1| PREDICTED: probable calcium-binding protein CML48 [Elaeis guineensis] gi|743873997|ref|XP_010906964.1| PREDICTED: probable calcium-binding protein CML48 [Elaeis guineensis] gi|743874001|ref|XP_010906965.1| PREDICTED: probable calcium-binding protein CML48 [Elaeis guineensis] gi|743874005|ref|XP_010906966.1| PREDICTED: probable calcium-binding protein CML48 [Elaeis guineensis] Length = 244 Score = 130 bits (327), Expect = 3e-28 Identities = 60/77 (77%), Positives = 68/77 (88%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T PEI+RSFQAVDRDRSG IDE+ELQ ALSSGYQKFS +TIRLLMFLF NP NPSK+GP Sbjct: 73 THPEIIRSFQAVDRDRSGFIDEYELQAALSSGYQKFSLRTIRLLMFLFQNPNNPSKMGPA 132 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW C+G+W+ IF+ Sbjct: 133 EFAALWNCIGQWQGIFD 149 >ref|XP_009393387.1| PREDICTED: probable calcium-binding protein CML48 [Musa acuminata subsp. malaccensis] Length = 236 Score = 124 bits (311), Expect = 2e-26 Identities = 57/76 (75%), Positives = 66/76 (86%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 TPPE++RSFQAVDRD+SG I+E ELQ ALSS Y KFS +T+RLLMFLF NP NPSK+GP Sbjct: 66 TPPEVIRSFQAVDRDQSGFIEESELQAALSSAYHKFSIRTVRLLMFLFKNPSNPSKMGPV 125 Query: 51 EFAALWKCLGEWRAIF 4 EFAALW CLG+W+AIF Sbjct: 126 EFAALWGCLGQWQAIF 141 >ref|XP_002275521.1| PREDICTED: probable calcium-binding protein CML48 [Vitis vinifera] Length = 225 Score = 122 bits (307), Expect = 7e-26 Identities = 58/77 (75%), Positives = 65/77 (84%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++RSFQ VDRDRSG IDE ELQ ALSSGYQ+FS +TIRLLMFLF NP +P IGP Sbjct: 54 THPDVIRSFQMVDRDRSGYIDEIELQQALSSGYQRFSLRTIRLLMFLFKNPSSPLGIGPN 113 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW CLG+WRAIFE Sbjct: 114 EFAALWSCLGQWRAIFE 130 >emb|CAN80623.1| hypothetical protein VITISV_043433 [Vitis vinifera] Length = 225 Score = 122 bits (307), Expect = 7e-26 Identities = 58/77 (75%), Positives = 65/77 (84%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++RSFQ VDRDRSG IDE ELQ ALSSGYQ+FS +TIRLLMFLF NP +P IGP Sbjct: 54 THPDVIRSFQMVDRDRSGYIDEIELQQALSSGYQRFSLRTIRLLMFLFKNPSSPLGIGPN 113 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW CLG+WRAIFE Sbjct: 114 EFAALWSCLGQWRAIFE 130 >ref|XP_012076123.1| PREDICTED: probable calcium-binding protein CML48 [Jatropha curcas] gi|643725315|gb|KDP34418.1| hypothetical protein JCGZ_12699 [Jatropha curcas] Length = 254 Score = 120 bits (301), Expect = 4e-25 Identities = 57/77 (74%), Positives = 65/77 (84%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++RSFQ VDRDRSG IDE ELQ ALSSGYQ+F +TIRLLMFLF NP +P +IGP Sbjct: 81 THPDVIRSFQMVDRDRSGYIDENELQQALSSGYQRFHIRTIRLLMFLFRNPYDPLRIGPK 140 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW CLG+WRAIFE Sbjct: 141 EFAALWSCLGQWRAIFE 157 >gb|KJB21714.1| hypothetical protein B456_004G009900 [Gossypium raimondii] Length = 193 Score = 119 bits (297), Expect = 1e-24 Identities = 54/77 (70%), Positives = 65/77 (84%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++R+FQ VDRDRSG IDE+ELQ ALSSGYQ+F+ +TIRLLMFLF NP + +IGP Sbjct: 68 TSPDVIRAFQMVDRDRSGFIDEYELQQALSSGYQRFNLRTIRLLMFLFKNPYDSLRIGPM 127 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW CLG WRA+FE Sbjct: 128 EFAALWSCLGHWRAVFE 144 >ref|XP_012472852.1| PREDICTED: probable calcium-binding protein CML48 [Gossypium raimondii] gi|763754382|gb|KJB21713.1| hypothetical protein B456_004G009900 [Gossypium raimondii] Length = 235 Score = 119 bits (297), Expect = 1e-24 Identities = 54/77 (70%), Positives = 65/77 (84%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++R+FQ VDRDRSG IDE+ELQ ALSSGYQ+F+ +TIRLLMFLF NP + +IGP Sbjct: 68 TSPDVIRAFQMVDRDRSGFIDEYELQQALSSGYQRFNLRTIRLLMFLFKNPYDSLRIGPM 127 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW CLG WRA+FE Sbjct: 128 EFAALWSCLGHWRAVFE 144 >gb|KHG08019.1| putative calcium-binding CML48 -like protein [Gossypium arboreum] Length = 235 Score = 119 bits (297), Expect = 1e-24 Identities = 54/77 (70%), Positives = 65/77 (84%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++R+FQ VDRDRSG IDE+ELQ ALSSGYQ+F+ +TIRLLMFLF NP + +IGP Sbjct: 68 TSPDVIRAFQMVDRDRSGFIDEYELQQALSSGYQRFNLRTIRLLMFLFKNPYDSLRIGPM 127 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW CLG WRA+FE Sbjct: 128 EFAALWSCLGHWRAVFE 144 >ref|XP_010271645.1| PREDICTED: probable calcium-binding protein CML48 [Nelumbo nucifera] Length = 227 Score = 119 bits (297), Expect = 1e-24 Identities = 55/77 (71%), Positives = 63/77 (81%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+I+RSFQ +DRDRSG +D+ ELQ LS GYQKFS +TIRLLMFLF NP PS+IGP Sbjct: 56 THPDIIRSFQMIDRDRSGFVDKNELQEVLSWGYQKFSLRTIRLLMFLFKNPTEPSRIGPV 115 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW CLG+WR IFE Sbjct: 116 EFAALWNCLGQWRVIFE 132 >ref|XP_007015806.1| Calcium-binding EF-hand family protein [Theobroma cacao] gi|508786169|gb|EOY33425.1| Calcium-binding EF-hand family protein [Theobroma cacao] Length = 307 Score = 118 bits (296), Expect = 1e-24 Identities = 56/77 (72%), Positives = 65/77 (84%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T PE++R+F+ VDRDRSG IDE ELQ ALSSGYQ+F+ +TIRLLMFLF NP + KIGP Sbjct: 66 THPEVIRAFEMVDRDRSGFIDENELQRALSSGYQRFNIRTIRLLMFLFKNPHDSLKIGPR 125 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW CLG+WRAIFE Sbjct: 126 EFAALWSCLGQWRAIFE 142 >ref|XP_011043032.1| PREDICTED: probable calcium-binding protein CML48 [Populus euphratica] Length = 243 Score = 117 bits (292), Expect = 4e-24 Identities = 54/77 (70%), Positives = 64/77 (83%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++RSF+ VDRDRSG IDE ELQ A+SSGYQ+FS +TIRLLMFLF NP +P + GP Sbjct: 70 TSPDVIRSFEMVDRDRSGFIDENELQQAISSGYQRFSIRTIRLLMFLFKNPHDPLRCGPK 129 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW CLG+WR IFE Sbjct: 130 EFAALWGCLGQWRGIFE 146 >ref|XP_002313594.1| hypothetical protein POPTR_0009s16510g [Populus trichocarpa] gi|222850002|gb|EEE87549.1| hypothetical protein POPTR_0009s16510g [Populus trichocarpa] Length = 247 Score = 117 bits (292), Expect = 4e-24 Identities = 54/77 (70%), Positives = 64/77 (83%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++RSF+ VDRDRSG IDE ELQ A+SSGYQ+FS +TIRLLMFLF NP +P + GP Sbjct: 74 TSPDVIRSFEMVDRDRSGFIDENELQQAVSSGYQRFSIRTIRLLMFLFKNPHDPLRFGPK 133 Query: 51 EFAALWKCLGEWRAIFE 1 EFAALW CLG+WR IFE Sbjct: 134 EFAALWGCLGQWRGIFE 150 >ref|XP_004139489.1| PREDICTED: probable calcium-binding protein CML48 [Cucumis sativus] gi|700209837|gb|KGN64933.1| hypothetical protein Csa_1G164670 [Cucumis sativus] Length = 251 Score = 116 bits (290), Expect = 7e-24 Identities = 53/77 (68%), Positives = 64/77 (83%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T PE++RSFQ VDRDRSG IDE ELQ ALSSGYQ+FS +T+RLL+FLF NP + S++GP Sbjct: 78 TSPEVIRSFQMVDRDRSGFIDENELQQALSSGYQRFSLRTVRLLIFLFRNPIDSSRMGPN 137 Query: 51 EFAALWKCLGEWRAIFE 1 EF ALW CLG+WR +FE Sbjct: 138 EFTALWNCLGQWRGMFE 154 >gb|KDO58092.1| hypothetical protein CISIN_1g025714mg [Citrus sinensis] Length = 207 Score = 115 bits (289), Expect = 9e-24 Identities = 55/77 (71%), Positives = 63/77 (81%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++RSF+ VDRDRSG IDE ELQ ALSSGYQ+FS TIRLLMFLF NP + +IGP Sbjct: 75 THPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFRNPHDSLRIGPK 134 Query: 51 EFAALWKCLGEWRAIFE 1 EFA LW CLG+WRAIFE Sbjct: 135 EFADLWSCLGQWRAIFE 151 >gb|KDO58091.1| hypothetical protein CISIN_1g025714mg [Citrus sinensis] Length = 249 Score = 115 bits (289), Expect = 9e-24 Identities = 55/77 (71%), Positives = 63/77 (81%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++RSF+ VDRDRSG IDE ELQ ALSSGYQ+FS TIRLLMFLF NP + +IGP Sbjct: 75 THPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFRNPHDSLRIGPK 134 Query: 51 EFAALWKCLGEWRAIFE 1 EFA LW CLG+WRAIFE Sbjct: 135 EFADLWSCLGQWRAIFE 151 >ref|XP_002523826.1| ef-hand calcium binding protein, putative [Ricinus communis] gi|223536914|gb|EEF38552.1| ef-hand calcium binding protein, putative [Ricinus communis] Length = 246 Score = 115 bits (289), Expect = 9e-24 Identities = 54/77 (70%), Positives = 62/77 (80%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++RSFQ VDRDRSG IDE ELQ ALSSGY +F +TIRLLMFLF NP +P +IGP Sbjct: 73 THPDVIRSFQMVDRDRSGFIDENELQQALSSGYHRFHIRTIRLLMFLFKNPHDPLRIGPK 132 Query: 51 EFAALWKCLGEWRAIFE 1 EF ALW CLG+WR IFE Sbjct: 133 EFTALWSCLGQWRGIFE 149 >ref|XP_006487936.1| PREDICTED: probable calcium-binding protein CML48-like [Citrus sinensis] Length = 249 Score = 115 bits (289), Expect = 9e-24 Identities = 55/77 (71%), Positives = 63/77 (81%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++RSF+ VDRDRSG IDE ELQ ALSSGYQ+FS TIRLLMFLF NP + +IGP Sbjct: 75 THPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFRNPHDSLRIGPK 134 Query: 51 EFAALWKCLGEWRAIFE 1 EFA LW CLG+WRAIFE Sbjct: 135 EFADLWSCLGQWRAIFE 151 >ref|XP_006424234.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] gi|557526168|gb|ESR37474.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] Length = 249 Score = 115 bits (289), Expect = 9e-24 Identities = 55/77 (71%), Positives = 63/77 (81%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++RSF+ VDRDRSG IDE ELQ ALSSGYQ+FS TIRLLMFLF NP + +IGP Sbjct: 75 THPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFKNPHDSLRIGPK 134 Query: 51 EFAALWKCLGEWRAIFE 1 EFA LW CLG+WRAIFE Sbjct: 135 EFADLWSCLGQWRAIFE 151 >ref|XP_006424233.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] gi|557526167|gb|ESR37473.1| hypothetical protein CICLE_v10029136mg [Citrus clementina] Length = 207 Score = 115 bits (289), Expect = 9e-24 Identities = 55/77 (71%), Positives = 63/77 (81%) Frame = -2 Query: 231 TPPEIVRSFQAVDRDRSGSIDEWELQTALSSGYQKFSRKTIRLLMFLFGNPKNPSKIGPT 52 T P+++RSF+ VDRDRSG IDE ELQ ALSSGYQ+FS TIRLLMFLF NP + +IGP Sbjct: 75 THPDVIRSFEMVDRDRSGFIDENELQQALSSGYQRFSLSTIRLLMFLFKNPHDSLRIGPK 134 Query: 51 EFAALWKCLGEWRAIFE 1 EFA LW CLG+WRAIFE Sbjct: 135 EFADLWSCLGQWRAIFE 151