BLASTX nr result
ID: Anemarrhena21_contig00011217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00011217 (241 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG06808.1| hypothetical protein F383_08210 [Gossypium arboreum] 59 1e-06 gb|ERN14813.1| hypothetical protein AMTR_s00032p00095920 [Ambore... 57 4e-06 >gb|KHG06808.1| hypothetical protein F383_08210 [Gossypium arboreum] Length = 264 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/50 (52%), Positives = 32/50 (64%) Frame = -2 Query: 240 AGNKDEAKDVVAEHEDKTDCVGHHHCSDPHHYLVCLPWLQMHLKLCSCSC 91 AGNKDE KDV +E+EDK D G+ C D +H VCLPWLQ+ + C Sbjct: 174 AGNKDEEKDVASEYEDKIDRFGYPDCLDSYHCAVCLPWLQLLKSVLDFPC 223 >gb|ERN14813.1| hypothetical protein AMTR_s00032p00095920 [Amborella trichopoda] Length = 233 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -2 Query: 228 DEAKDVVAEHEDKTDCVGHHHCSDPHHYLVCLPWLQM 118 DE +DVVAE+EDK DC G+ C D HH LV LPWLQ+ Sbjct: 178 DEEEDVVAEYEDKADCFGYSDCLDSHHRLVYLPWLQL 214