BLASTX nr result
ID: Anemarrhena21_contig00010552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00010552 (292 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010055609.1| PREDICTED: protein P21-like [Eucalyptus gran... 105 9e-21 ref|XP_010055611.1| PREDICTED: protein P21-like [Eucalyptus gran... 105 9e-21 gb|KCW72117.1| hypothetical protein EUGRSUZ_E00557 [Eucalyptus g... 105 9e-21 ref|XP_008369460.1| PREDICTED: protein P21 [Malus domestica] 105 1e-20 gb|ACU31848.1| thaumatin-like protein [Nepenthes rafflesiana] 104 2e-20 gb|ACU31845.1| thaumatin-like protein [Nepenthes x henryana] 104 2e-20 gb|ACU31847.1| thaumatin-like protein [Nepenthes mirabilis] 104 3e-20 gb|ABC73397.1| thaumatin-like protein [Nepenthes gracilis] gi|25... 104 3e-20 ref|XP_010676518.1| PREDICTED: protein P21-like [Beta vulgaris s... 103 3e-20 ref|XP_010906392.1| PREDICTED: thaumatin-like protein [Elaeis gu... 103 4e-20 gb|ACU31849.1| thaumatin-like protein [Nepenthes singalana] gi|2... 103 4e-20 dbj|BAF98917.1| thaumatin like protein [Nepenthes alata] 103 4e-20 dbj|BAF98916.1| thaumatin like protein [Nepenthes alata] 103 4e-20 ref|XP_010661214.1| PREDICTED: protein P21 [Vitis vinifera] gi|1... 103 4e-20 ref|XP_008238906.1| PREDICTED: protein P21-like [Prunus mume] 103 6e-20 gb|KMT12126.1| hypothetical protein BVRB_5g100770 [Beta vulgaris... 102 7e-20 ref|XP_010676513.1| PREDICTED: protein P21-like [Beta vulgaris s... 102 7e-20 ref|XP_009345456.1| PREDICTED: thaumatin-like protein [Pyrus x b... 102 7e-20 ref|XP_002283064.1| PREDICTED: protein P21-like [Vitis vinifera] 102 7e-20 gb|AGC39176.1| thaumatin-like protein [Actinidia chinensis] 102 7e-20 >ref|XP_010055609.1| PREDICTED: protein P21-like [Eucalyptus grandis] Length = 226 Score = 105 bits (263), Expect = 9e-21 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPTDYS+YFK+ CPDAYSYPKDDATS FTCP G NYKVVFCP Sbjct: 178 CCNSGSCGPTDYSRYFKDRCPDAYSYPKDDATSVFTCPGGTNYKVVFCP 226 >ref|XP_010055611.1| PREDICTED: protein P21-like [Eucalyptus grandis] gi|629106973|gb|KCW72119.1| hypothetical protein EUGRSUZ_E00560 [Eucalyptus grandis] Length = 235 Score = 105 bits (263), Expect = 9e-21 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPTDYS+YFK+ CPDAYSYPKDDATS FTCP G NYKVVFCP Sbjct: 187 CCNSGSCGPTDYSRYFKDRCPDAYSYPKDDATSVFTCPGGTNYKVVFCP 235 >gb|KCW72117.1| hypothetical protein EUGRSUZ_E00557 [Eucalyptus grandis] Length = 196 Score = 105 bits (263), Expect = 9e-21 Identities = 43/49 (87%), Positives = 45/49 (91%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPTDYS+YFK+ CPDAYSYPKDDATS FTCP G NYKVVFCP Sbjct: 148 CCNSGSCGPTDYSRYFKDRCPDAYSYPKDDATSVFTCPGGTNYKVVFCP 196 >ref|XP_008369460.1| PREDICTED: protein P21 [Malus domestica] Length = 225 Score = 105 bits (262), Expect = 1e-20 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSG+C PTD+S++FKNLCPDAYSYPKDDATSTFTCP+G NYKVVFCP Sbjct: 177 CCNSGTCDPTDFSRFFKNLCPDAYSYPKDDATSTFTCPTGTNYKVVFCP 225 >gb|ACU31848.1| thaumatin-like protein [Nepenthes rafflesiana] Length = 225 Score = 104 bits (260), Expect = 2e-20 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPT YS++FKNLCP+AYSYPKDDATST+TCP G NYKVVFCP Sbjct: 177 CCNSGSCGPTSYSEFFKNLCPNAYSYPKDDATSTYTCPGGTNYKVVFCP 225 >gb|ACU31845.1| thaumatin-like protein [Nepenthes x henryana] Length = 225 Score = 104 bits (260), Expect = 2e-20 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPT YS++FKNLCP+AYSYPKDDATST+TCP G NYKVVFCP Sbjct: 177 CCNSGSCGPTSYSEFFKNLCPNAYSYPKDDATSTYTCPGGTNYKVVFCP 225 >gb|ACU31847.1| thaumatin-like protein [Nepenthes mirabilis] Length = 225 Score = 104 bits (259), Expect = 3e-20 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSC PT YS++FKNLCPDAYSYPKDDATST+TCP G NYKVVFCP Sbjct: 177 CCNSGSCSPTSYSEFFKNLCPDAYSYPKDDATSTYTCPGGTNYKVVFCP 225 >gb|ABC73397.1| thaumatin-like protein [Nepenthes gracilis] gi|255740175|gb|ACU31844.1| thaumatin-like protein [Nepenthes gracilis] Length = 225 Score = 104 bits (259), Expect = 3e-20 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSC PT YS++FKNLCPDAYSYPKDDATST+TCP G NYKVVFCP Sbjct: 177 CCNSGSCSPTSYSEFFKNLCPDAYSYPKDDATSTYTCPGGTNYKVVFCP 225 >ref|XP_010676518.1| PREDICTED: protein P21-like [Beta vulgaris subsp. vulgaris] gi|870860822|gb|KMT12130.1| hypothetical protein BVRB_5g100820 [Beta vulgaris subsp. vulgaris] Length = 227 Score = 103 bits (258), Expect = 3e-20 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPTDYS+YFK CPDAYSYPKDDATSTFTCP+G NY V FCP Sbjct: 179 CCNSGSCGPTDYSRYFKGKCPDAYSYPKDDATSTFTCPTGTNYMVTFCP 227 >ref|XP_010906392.1| PREDICTED: thaumatin-like protein [Elaeis guineensis] Length = 164 Score = 103 bits (257), Expect = 4e-20 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSG CGPT+YSK+FKN CPDAYSYPKDD TSTFTCP G NYKV+FCP Sbjct: 116 CCNSGGCGPTNYSKFFKNRCPDAYSYPKDDQTSTFTCPGGTNYKVIFCP 164 >gb|ACU31849.1| thaumatin-like protein [Nepenthes singalana] gi|255740187|gb|ACU31850.1| thaumatin-like protein [Nepenthes ventricosa] Length = 225 Score = 103 bits (257), Expect = 4e-20 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPT YS++FKNLCP+AY+YPKDDATST+TCP G NYKVVFCP Sbjct: 177 CCNSGSCGPTSYSEFFKNLCPNAYNYPKDDATSTYTCPGGTNYKVVFCP 225 >dbj|BAF98917.1| thaumatin like protein [Nepenthes alata] Length = 225 Score = 103 bits (257), Expect = 4e-20 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPTDYS+YFK LCP+AYSYPKDDATST+TC G NYKVVFCP Sbjct: 177 CCNSGSCGPTDYSRYFKGLCPNAYSYPKDDATSTYTCSGGTNYKVVFCP 225 >dbj|BAF98916.1| thaumatin like protein [Nepenthes alata] Length = 225 Score = 103 bits (257), Expect = 4e-20 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPTDYS+YFK LCP+AYSYPKDDATST+TC G NYKVVFCP Sbjct: 177 CCNSGSCGPTDYSRYFKGLCPNAYSYPKDDATSTYTCSGGTNYKVVFCP 225 >ref|XP_010661214.1| PREDICTED: protein P21 [Vitis vinifera] gi|147857465|emb|CAN82850.1| hypothetical protein VITISV_030860 [Vitis vinifera] Length = 225 Score = 103 bits (257), Expect = 4e-20 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPTDYS+YFK CPDAYSYPKDD TSTFTCP G NY+V+FCP Sbjct: 177 CCNSGSCGPTDYSRYFKTRCPDAYSYPKDDQTSTFTCPGGTNYEVIFCP 225 >ref|XP_008238906.1| PREDICTED: protein P21-like [Prunus mume] Length = 226 Score = 103 bits (256), Expect = 6e-20 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPTD+SK+FK+ CPDAYSYPKDD TSTFTCP+G NY+VVFCP Sbjct: 178 CCNSGSCGPTDFSKFFKDRCPDAYSYPKDDQTSTFTCPTGTNYRVVFCP 226 >gb|KMT12126.1| hypothetical protein BVRB_5g100770 [Beta vulgaris subsp. vulgaris] Length = 227 Score = 102 bits (255), Expect = 7e-20 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSG+CGPTDYS+YFK CPDAYSYPKDDATSTFTCP+G NY V FCP Sbjct: 179 CCNSGNCGPTDYSRYFKGKCPDAYSYPKDDATSTFTCPTGTNYMVTFCP 227 >ref|XP_010676513.1| PREDICTED: protein P21-like [Beta vulgaris subsp. vulgaris] Length = 284 Score = 102 bits (255), Expect = 7e-20 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSG+CGPTDYS+YFK CPDAYSYPKDDATSTFTCP+G NY V FCP Sbjct: 236 CCNSGNCGPTDYSRYFKGKCPDAYSYPKDDATSTFTCPTGTNYMVTFCP 284 >ref|XP_009345456.1| PREDICTED: thaumatin-like protein [Pyrus x bretschneideri] Length = 225 Score = 102 bits (255), Expect = 7e-20 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSG+CGPTD+SK+FK+ CPDAYSYPKDD TSTFTCP G NYKVVFCP Sbjct: 177 CCNSGNCGPTDFSKFFKSRCPDAYSYPKDDQTSTFTCPGGTNYKVVFCP 225 >ref|XP_002283064.1| PREDICTED: protein P21-like [Vitis vinifera] Length = 225 Score = 102 bits (255), Expect = 7e-20 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSGSCGPTDYS+YFK CPDAYSYPKDD TSTFTCP G NY V+FCP Sbjct: 177 CCNSGSCGPTDYSRYFKTRCPDAYSYPKDDQTSTFTCPGGTNYDVIFCP 225 >gb|AGC39176.1| thaumatin-like protein [Actinidia chinensis] Length = 225 Score = 102 bits (255), Expect = 7e-20 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = -1 Query: 292 CCNSGSCGPTDYSKYFKNLCPDAYSYPKDDATSTFTCPSGANYKVVFCP 146 CCNSG+CGPTDYS++FK CPDAYSYPKDD TSTFTCP G NYKVVFCP Sbjct: 177 CCNSGNCGPTDYSRFFKTRCPDAYSYPKDDQTSTFTCPGGTNYKVVFCP 225