BLASTX nr result
ID: Anemarrhena21_contig00009684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00009684 (346 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010927029.1| PREDICTED: putative UPF0481 protein At3g0264... 69 2e-09 ref|XP_008807192.1| PREDICTED: putative UPF0481 protein At3g0264... 67 6e-09 ref|XP_008666123.1| PREDICTED: putative UPF0481 protein At3g0264... 65 1e-08 gb|EEE59435.1| hypothetical protein OsJ_11607 [Oryza sativa Japo... 62 1e-07 gb|EAY90837.1| hypothetical protein OsI_12441 [Oryza sativa Indi... 62 1e-07 gb|AAT81750.1| hypothetical protein [Oryza sativa Japonica Group] 62 1e-07 gb|AAR06336.1| hypothetical protein [Oryza sativa Japonica Group... 62 1e-07 ref|XP_007139376.1| hypothetical protein PHAVU_008G024200g [Phas... 61 3e-07 ref|XP_004986874.1| PREDICTED: putative UPF0481 protein At3g0264... 61 3e-07 ref|XP_009394006.1| PREDICTED: putative UPF0481 protein At3g0264... 60 4e-07 gb|EMT20139.1| hypothetical protein F775_14017 [Aegilops tauschii] 60 6e-07 ref|XP_011004989.1| PREDICTED: putative UPF0481 protein At3g0264... 60 7e-07 ref|XP_002530455.1| hypothetical protein RCOM_0011030 [Ricinus c... 59 1e-06 ref|XP_002530454.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 ref|XP_002313925.1| hypothetical protein POPTR_0009s08870g [Popu... 59 1e-06 ref|XP_002465056.1| hypothetical protein SORBIDRAFT_01g031420 [S... 59 2e-06 ref|XP_008461157.1| PREDICTED: putative UPF0481 protein At3g0264... 58 2e-06 ref|XP_002304083.1| hypothetical protein POPTR_0003s01870g [Popu... 58 2e-06 ref|XP_011045249.1| PREDICTED: putative UPF0481 protein At3g0264... 58 3e-06 ref|XP_009385543.1| PREDICTED: putative UPF0481 protein At3g0264... 58 3e-06 >ref|XP_010927029.1| PREDICTED: putative UPF0481 protein At3g02645 [Elaeis guineensis] Length = 532 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/52 (55%), Positives = 43/52 (82%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH+REELH MER+KLSAA++ + +L ++ F+ +VD+ K+E+RIRA+Y R Sbjct: 60 PYHHHREELHDMERYKLSAAKRTQNQLSNLKFQNLVDLIAKLEHRIRAHYYR 111 >ref|XP_008807192.1| PREDICTED: putative UPF0481 protein At3g02645 [Phoenix dactylifera] Length = 535 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/52 (55%), Positives = 41/52 (78%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH REELH MER+KLSAA++ + +L ++ F+ +VD+ K+E+RIRA Y R Sbjct: 62 PYHHRREELHDMERYKLSAAKRTQNQLSNLKFQNLVDLIAKLEHRIRANYYR 113 >ref|XP_008666123.1| PREDICTED: putative UPF0481 protein At3g02645 [Zea mays] gi|414867388|tpg|DAA45945.1| TPA: hypothetical protein ZEAMMB73_973776 [Zea mays] Length = 537 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/52 (55%), Positives = 40/52 (76%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH REE+ MER+KLSAA++ + L DM F+ +VDVF K+E+ +RA+Y R Sbjct: 61 PYHHCREEICDMERYKLSAAKRAQSHLPDMDFQKLVDVFTKLEHLVRAHYHR 112 >gb|EEE59435.1| hypothetical protein OsJ_11607 [Oryza sativa Japonica Group] Length = 529 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH REEL ME +KLSAAR+ + L M F+ +V VF +E+ IRAYY R Sbjct: 60 PYHHCREELRDMEMYKLSAARRAQRHLPGMSFQQLVAVFATLEFEIRAYYHR 111 >gb|EAY90837.1| hypothetical protein OsI_12441 [Oryza sativa Indica Group] Length = 445 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH REEL ME +KLSAAR+ + L M F+ +V VF +E+ IRAYY R Sbjct: 60 PYHHCREELRDMEMYKLSAARRAQRHLPGMSFQQLVAVFATLEFEIRAYYHR 111 >gb|AAT81750.1| hypothetical protein [Oryza sativa Japonica Group] Length = 553 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH REEL ME +KLSAAR+ + L M F+ +V VF +E+ IRAYY R Sbjct: 84 PYHHCREELRDMEMYKLSAARRAQRHLPGMSFQQLVAVFATLEFEIRAYYHR 135 >gb|AAR06336.1| hypothetical protein [Oryza sativa Japonica Group] gi|108709607|gb|ABF97402.1| pentatricopeptide, putative [Oryza sativa Japonica Group] Length = 582 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/52 (55%), Positives = 36/52 (69%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH REEL ME +KLSAAR+ + L M F+ +V VF +E+ IRAYY R Sbjct: 113 PYHHCREELRDMEMYKLSAARRAQRHLPGMSFQQLVAVFATLEFEIRAYYHR 164 >ref|XP_007139376.1| hypothetical protein PHAVU_008G024200g [Phaseolus vulgaris] gi|561012509|gb|ESW11370.1| hypothetical protein PHAVU_008G024200g [Phaseolus vulgaris] Length = 559 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH R+EL++MER+K+++A++ + +LQ + E+IVD K+E+RIRA Y R Sbjct: 67 PYHHWRQELYEMERYKIASAKRFQEQLQSLKLEHIVDQLMKLEHRIRACYHR 118 >ref|XP_004986874.1| PREDICTED: putative UPF0481 protein At3g02645 [Setaria italica] Length = 534 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH REEL MER+KLSAA++ + L F+ +VD F K+E+ IRA+Y R Sbjct: 60 PYHHCREELGDMERYKLSAAKRAQSHLPGTDFQQLVDAFTKLEHLIRAHYHR 111 >ref|XP_009394006.1| PREDICTED: putative UPF0481 protein At3g02645 [Musa acuminata subsp. malaccensis] Length = 547 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR*YSF 170 PYH +REELH MER+KL+AAR+++ RL + F +V +F K+E IRA+Y R F Sbjct: 61 PYHRHREELHDMERYKLAAARRMQSRLPGVKFLDVVALFIKLELPIRAHYHRYLKF 116 >gb|EMT20139.1| hypothetical protein F775_14017 [Aegilops tauschii] Length = 544 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/52 (51%), Positives = 36/52 (69%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH RE L ME +KLSAA++ + L M F+ +VDVF E+RIR++Y R Sbjct: 60 PYHHCREGLRDMEMYKLSAAKRAQSHLTSMNFQQLVDVFATFEHRIRSHYHR 111 >ref|XP_011004989.1| PREDICTED: putative UPF0481 protein At3g02645 [Populus euphratica] gi|743943084|ref|XP_011016041.1| PREDICTED: putative UPF0481 protein At3g02645 [Populus euphratica] Length = 551 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/56 (48%), Positives = 41/56 (73%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR*YSF 170 PYH+ R +LH+MER+KLSAA+K++ +LQ + FE +V+ K+E +IRA Y + F Sbjct: 70 PYHYRRADLHEMERYKLSAAKKLQNQLQSLRFENLVEQLIKLEPQIRACYHKYLDF 125 >ref|XP_002530455.1| hypothetical protein RCOM_0011030 [Ricinus communis] gi|223530000|gb|EEF31925.1| hypothetical protein RCOM_0011030 [Ricinus communis] Length = 405 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/67 (44%), Positives = 43/67 (64%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR*YSFPMKY 182 PYHH R EL +MER+KLSA +++R +LQ + F +VD F E +IRA Y + +F + Sbjct: 63 PYHHERPELFEMERYKLSATKRVRKQLQILKFHSLVDHFINFETKIRACYNKYLNFNGET 122 Query: 183 LHVFIVL 203 L I+L Sbjct: 123 LAWMIIL 129 >ref|XP_002530454.1| conserved hypothetical protein [Ricinus communis] gi|223529999|gb|EEF31924.1| conserved hypothetical protein [Ricinus communis] Length = 531 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/52 (50%), Positives = 41/52 (78%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH R E+++MER+KL+AA++ + +LQ++ F+YIVD ++E +IRA Y R Sbjct: 67 PYHHWRPEIYEMERYKLAAAKRTQKQLQNVKFQYIVDHLTELEPKIRASYHR 118 >ref|XP_002313925.1| hypothetical protein POPTR_0009s08870g [Populus trichocarpa] gi|222850333|gb|EEE87880.1| hypothetical protein POPTR_0009s08870g [Populus trichocarpa] Length = 559 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/56 (46%), Positives = 41/56 (73%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR*YSF 170 PYHH R EL++MER+KL+AA++ + ++Q + F++IVD K+E +IRA Y + F Sbjct: 67 PYHHWRPELYEMERYKLAAAKRTQKKIQSLKFQHIVDHLSKLELKIRACYHKFLDF 122 >ref|XP_002465056.1| hypothetical protein SORBIDRAFT_01g031420 [Sorghum bicolor] gi|241918910|gb|EER92054.1| hypothetical protein SORBIDRAFT_01g031420 [Sorghum bicolor] Length = 540 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/52 (50%), Positives = 38/52 (73%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR 158 PYHH RE+L M+R KLSAA++ + L M F+++VDVF +E+ +RA+Y R Sbjct: 61 PYHHCREQLCDMDRCKLSAAKRAQSHLPAMDFQHLVDVFTNLEHLVRAHYHR 112 >ref|XP_008461157.1| PREDICTED: putative UPF0481 protein At3g02645 [Cucumis melo] Length = 574 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/56 (46%), Positives = 40/56 (71%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR*YSF 170 PYHH R+EL+ MER+K++AA+K + +LQ + F +V+ K E +IRAYY + +F Sbjct: 75 PYHHWRQELYVMERYKIAAAKKAQKQLQSLKFHNLVEKLAKYERKIRAYYHKYLNF 130 >ref|XP_002304083.1| hypothetical protein POPTR_0003s01870g [Populus trichocarpa] gi|222841515|gb|EEE79062.1| hypothetical protein POPTR_0003s01870g [Populus trichocarpa] Length = 544 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/56 (48%), Positives = 40/56 (71%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR*YSF 170 PYH+ R +LH+MER+KLSAA+K++ +LQ FE +V+ K+E +IRA Y + F Sbjct: 63 PYHYRRADLHEMERYKLSAAKKLQNQLQSHRFENLVEQLIKLEPQIRACYHKYLDF 118 >ref|XP_011045249.1| PREDICTED: putative UPF0481 protein At3g02645 [Populus euphratica] Length = 545 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/62 (46%), Positives = 42/62 (67%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR*YSFPMKY 182 PYH++R ELH+M+R+KLSAA++ + RLQ + F +V+ K+E +IRA Y KY Sbjct: 67 PYHYSRLELHEMDRYKLSAAKRSQKRLQSLKFRDLVEQLMKLESKIRACYH-------KY 119 Query: 183 LH 188 LH Sbjct: 120 LH 121 >ref|XP_009385543.1| PREDICTED: putative UPF0481 protein At3g02645, partial [Musa acuminata subsp. malaccensis] Length = 347 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/56 (42%), Positives = 41/56 (73%) Frame = +3 Query: 3 PYHHNREELHQMERHKLSAARKIRIRLQDMGFEYIVDVFCKVEYRIRAYYQR*YSF 170 PYHH R EL++MER+KL+AAR+ + + + +++++ F K+E++IRA+Y R F Sbjct: 71 PYHHWRPELYEMERYKLAAARRTQKQFHTIKLQHLIEQFTKLEHKIRAHYHRYLDF 126