BLASTX nr result
ID: Anemarrhena21_contig00009336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00009336 (232 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009414992.1| PREDICTED: uncharacterized protein LOC103995... 61 3e-07 >ref|XP_009414992.1| PREDICTED: uncharacterized protein LOC103995951 isoform X1 [Musa acuminata subsp. malaccensis] Length = 105 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = -1 Query: 148 PQNTPHSWVTRAKNTKNFASKSGGLSFIQVSKGCKTCRGQGAIECAGCE 2 PQ PH W TRAK + ASK G +S VSKGC+ C G+GAIEC GC+ Sbjct: 13 PQPCPHPWQTRAKRSGVSASKYGAVSVKPVSKGCQKCGGKGAIECPGCK 61