BLASTX nr result
ID: Anemarrhena21_contig00009195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00009195 (268 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phas... 96 1e-17 gb|AES99104.2| hypothetical protein MTR_5g076600 [Medicago trunc... 94 3e-17 ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago ... 94 3e-17 tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea m... 94 4e-17 gb|KDP35707.1| hypothetical protein JCGZ_10479 [Jatropha curcas] 88 2e-15 gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] 87 6e-15 gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlise... 84 5e-14 dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] 84 5e-14 ref|XP_010227917.1| PREDICTED: uncharacterized protein LOC100843... 77 5e-12 >ref|XP_007141973.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] gi|561015106|gb|ESW13967.1| hypothetical protein PHAVU_008G241600g [Phaseolus vulgaris] Length = 60 Score = 95.5 bits (236), Expect = 1e-17 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = +1 Query: 43 MRVFGKHIFPRQILLMASGLLFLGATTYDVHRSIKNNEMPPSPEQIKAFQDYLEAKRR 216 MR+FGKH+FP QI+L ASGLLF +TTYDVHRSIKNN+ PPS EQ+KA QDY+E+ RR Sbjct: 1 MRIFGKHVFPSQIILFASGLLFFASTTYDVHRSIKNNQTPPSQEQLKALQDYIESARR 58 >gb|AES99104.2| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 60 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/60 (70%), Positives = 52/60 (86%) Frame = +1 Query: 43 MRVFGKHIFPRQILLMASGLLFLGATTYDVHRSIKNNEMPPSPEQIKAFQDYLEAKRRPP 222 MR+FGK +FPRQI+L ASGLLFL +TTYDVHRSIKNNE PPS EQ+KA ++Y+++ RR P Sbjct: 1 MRIFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRRSP 60 >ref|XP_003616146.1| hypothetical protein MTR_5g076600 [Medicago truncatula] Length = 119 Score = 94.4 bits (233), Expect = 3e-17 Identities = 42/60 (70%), Positives = 52/60 (86%) Frame = +1 Query: 43 MRVFGKHIFPRQILLMASGLLFLGATTYDVHRSIKNNEMPPSPEQIKAFQDYLEAKRRPP 222 MR+FGK +FPRQI+L ASGLLFL +TTYDVHRSIKNNE PPS EQ+KA ++Y+++ RR P Sbjct: 1 MRIFGKPVFPRQIILFASGLLFLASTTYDVHRSIKNNETPPSEEQLKALEEYIKSVRRQP 60 >tpg|DAA40722.1| TPA: hypothetical protein ZEAMMB73_194935 [Zea mays] Length = 750 Score = 94.0 bits (232), Expect = 4e-17 Identities = 43/65 (66%), Positives = 54/65 (83%), Gaps = 1/65 (1%) Frame = +1 Query: 34 RLKMRVFGKHIFPRQILLMASGLLFLGATTYDVHRSIKNNEMPPSPEQIKAFQDYLEAKR 213 R MR+FGKH+FPRQI+L A+G++F GATTYDVHRSIKNNE PP+ EQ++A QDY+ +K Sbjct: 684 RGSMRLFGKHVFPRQIVLFAAGMVFFGATTYDVHRSIKNNEQPPTREQMEALQDYINSKN 743 Query: 214 -RPPP 225 R PP Sbjct: 744 PRGPP 748 >gb|KDP35707.1| hypothetical protein JCGZ_10479 [Jatropha curcas] Length = 60 Score = 88.2 bits (217), Expect = 2e-15 Identities = 38/60 (63%), Positives = 51/60 (85%) Frame = +1 Query: 43 MRVFGKHIFPRQILLMASGLLFLGATTYDVHRSIKNNEMPPSPEQIKAFQDYLEAKRRPP 222 M++FGK++ P QI+LMASG++FL +TTYDVHRSIKNNE PPS EQ++A +DY+ +KR P Sbjct: 1 MKIFGKYVSPGQIMLMASGVVFLASTTYDVHRSIKNNETPPSKEQMEALEDYIRSKRASP 60 >gb|EMT14912.1| hypothetical protein F775_27789 [Aegilops tauschii] Length = 58 Score = 86.7 bits (213), Expect = 6e-15 Identities = 36/58 (62%), Positives = 50/58 (86%) Frame = +1 Query: 43 MRVFGKHIFPRQILLMASGLLFLGATTYDVHRSIKNNEMPPSPEQIKAFQDYLEAKRR 216 MRV G+H+ PRQI L+A+GL+F GATTYDVHRSIKNN+ PP+ EQ+ A QD++++++R Sbjct: 1 MRVLGRHVSPRQIALLAAGLVFFGATTYDVHRSIKNNDQPPTREQVAALQDFIDSRKR 58 >gb|EPS67586.1| hypothetical protein M569_07192, partial [Genlisea aurea] Length = 58 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/58 (63%), Positives = 48/58 (82%) Frame = +1 Query: 43 MRVFGKHIFPRQILLMASGLLFLGATTYDVHRSIKNNEMPPSPEQIKAFQDYLEAKRR 216 M++FGK I RQI + ++G+LF ATTYDVHRSIKNNE PPSPEQI+A +DY+++ RR Sbjct: 1 MKIFGKQISGRQIAVFSAGVLFFAATTYDVHRSIKNNEAPPSPEQIQALEDYIDSVRR 58 >dbj|BAK05462.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 58 Score = 83.6 bits (205), Expect = 5e-14 Identities = 34/58 (58%), Positives = 50/58 (86%) Frame = +1 Query: 43 MRVFGKHIFPRQILLMASGLLFLGATTYDVHRSIKNNEMPPSPEQIKAFQDYLEAKRR 216 MR+ G+H+ PRQI+L+A+GL+F GATTYDVHRSIKNN+ PP+ EQ+ A Q ++++++R Sbjct: 1 MRLLGRHVSPRQIVLLAAGLVFFGATTYDVHRSIKNNDQPPTSEQVAALQAFIDSRKR 58 >ref|XP_010227917.1| PREDICTED: uncharacterized protein LOC100843543 [Brachypodium distachyon] Length = 119 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/52 (65%), Positives = 42/52 (80%) Frame = +1 Query: 43 MRVFGKHIFPRQILLMASGLLFLGATTYDVHRSIKNNEMPPSPEQIKAFQDY 198 MR GKH+ PRQ+ L A+GL+F GATTYDVHRSIKNN+ PP+ EQ++A Q Y Sbjct: 1 MRPLGKHVSPRQVALFAAGLVFFGATTYDVHRSIKNNDQPPTREQMEALQVY 52