BLASTX nr result
ID: Anemarrhena21_contig00009189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00009189 (461 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009413396.1| PREDICTED: fatty-acid-binding protein 3 [Mus... 57 6e-06 >ref|XP_009413396.1| PREDICTED: fatty-acid-binding protein 3 [Musa acuminata subsp. malaccensis] Length = 274 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/51 (56%), Positives = 35/51 (68%) Frame = -2 Query: 184 SYSLLRPFPPLTPKASDRSVEYVVEPSTNVKLPYKLTFPGCSDSLVLLRTG 32 ++ L R P TP+AS S +YVVEP T+VK P +L PGCS SLVLL TG Sbjct: 49 AHPLGRTRPDSTPRASVGSADYVVEPGTSVKFPKELQVPGCSSSLVLLGTG 99