BLASTX nr result
ID: Anemarrhena21_contig00008986
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00008986 (601 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008776163.1| PREDICTED: iron-sulfur assembly protein IscA... 41 3e-06 ref|XP_010915159.1| PREDICTED: iron-sulfur assembly protein IscA... 39 7e-06 >ref|XP_008776163.1| PREDICTED: iron-sulfur assembly protein IscA, chloroplastic [Phoenix dactylifera] Length = 178 Score = 40.8 bits (94), Expect(3) = 3e-06 Identities = 22/46 (47%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +3 Query: 141 TLRFDPR---RRGISLSTRCSAALVCDPKCLLILYGMPLDFSDGLM 269 T+ FD R R S+ +VCDPK LL +YGM LDFSD L+ Sbjct: 98 TMEFDSRANTRSDDSVIEYDGFTIVCDPKSLLFIYGMQLDFSDALI 143 Score = 30.4 bits (67), Expect(3) = 3e-06 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 274 FLIQEPKCYQTCGCGKSFSAE 336 F + P QTC CGKSF+A+ Sbjct: 147 FSFKNPNAMQTCSCGKSFAAD 167 Score = 26.2 bits (56), Expect(3) = 3e-06 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 269 GGFSFKNPNA 298 GGFSFKNPNA Sbjct: 145 GGFSFKNPNA 154 >ref|XP_010915159.1| PREDICTED: iron-sulfur assembly protein IscA, chloroplastic [Elaeis guineensis] Length = 178 Score = 39.3 bits (90), Expect(3) = 7e-06 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = +3 Query: 201 LVCDPKCLLILYGMPLDFSDGLM 269 +VCDPK LL +YGM LDFSD L+ Sbjct: 121 IVCDPKSLLFIYGMQLDFSDALI 143 Score = 30.4 bits (67), Expect(3) = 7e-06 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 274 FLIQEPKCYQTCGCGKSFSAE 336 F + P QTC CGKSF+A+ Sbjct: 147 FSFKNPNAMQTCSCGKSFAAD 167 Score = 26.2 bits (56), Expect(3) = 7e-06 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 269 GGFSFKNPNA 298 GGFSFKNPNA Sbjct: 145 GGFSFKNPNA 154