BLASTX nr result
ID: Anemarrhena21_contig00008785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00008785 (416 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009413267.1| PREDICTED: poly(rC)-binding protein 3 [Musa ... 57 4e-06 >ref|XP_009413267.1| PREDICTED: poly(rC)-binding protein 3 [Musa acuminata subsp. malaccensis] Length = 476 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 2/31 (6%) Frame = -3 Query: 87 PTKEGG--EIKKWPGWPGDNVFRMVVPVIKV 1 PT +GG E+KKWPGWPGDNVFR+VVPV+KV Sbjct: 71 PTAQGGGVEVKKWPGWPGDNVFRLVVPVLKV 101