BLASTX nr result
ID: Anemarrhena21_contig00008145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00008145 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010934083.1| PREDICTED: probable carboxylesterase 8 [Elae... 62 1e-07 ref|XP_011091163.1| PREDICTED: probable carboxylesterase 8 [Sesa... 61 3e-07 ref|XP_003529985.1| PREDICTED: probable carboxylesterase 8-like ... 59 2e-06 ref|XP_010693639.1| PREDICTED: carboxylesterase 1-like [Beta vul... 58 2e-06 gb|EPS59852.1| hypothetical protein M569_14952, partial [Genlise... 56 8e-06 >ref|XP_010934083.1| PREDICTED: probable carboxylesterase 8 [Elaeis guineensis] Length = 328 Score = 62.0 bits (149), Expect = 1e-07 Identities = 33/49 (67%), Positives = 35/49 (71%) Frame = -3 Query: 155 MDPYKLLQISLNPDGSLSRYLDIPIVPPTGENPSPDSSAPALSKDVPLN 9 MDPY+ L IS NPDGSLSR IP PPTG+ P S PALSKDVPLN Sbjct: 3 MDPYQFLHISRNPDGSLSRANLIPNSPPTGDQPL--DSVPALSKDVPLN 49 >ref|XP_011091163.1| PREDICTED: probable carboxylesterase 8 [Sesamum indicum] Length = 341 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 2/50 (4%) Frame = -3 Query: 152 DPYKLLQISLNPDGSLSRYLDIPIVPPTGENPSP-DSSAP-ALSKDVPLN 9 DPYKLL +S NPDGS++R IP +PPT P P DS AP ALSKDVPLN Sbjct: 10 DPYKLLNLSPNPDGSITRLNQIPTLPPTPHIPPPSDSPAPLALSKDVPLN 59 >ref|XP_003529985.1| PREDICTED: probable carboxylesterase 8-like [Glycine max] Length = 334 Score = 58.5 bits (140), Expect = 2e-06 Identities = 35/70 (50%), Positives = 42/70 (60%), Gaps = 1/70 (1%) Frame = -3 Query: 209 LSPHTPPNSXXXXXXXXQMDPYKLLQISLNPDG-SLSRYLDIPIVPPTGENPSPDSSAPA 33 +S PP+S MDPY L+I LNPDG SL+R +P VPP+ PS S PA Sbjct: 1 MSEPPPPSSSA-------MDPYDFLKIKLNPDGNSLTRNYVVPTVPPSATTPS---SEPA 50 Query: 32 LSKDVPLNET 3 LSKD+PLN T Sbjct: 51 LSKDIPLNPT 60 >ref|XP_010693639.1| PREDICTED: carboxylesterase 1-like [Beta vulgaris subsp. vulgaris] gi|870846349|gb|KMS98925.1| hypothetical protein BVRB_3g067260 [Beta vulgaris subsp. vulgaris] Length = 336 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = -3 Query: 155 MDPYKLLQISLNPDGSLSRYLDIPIVPPTGENPSPDSSAPALSKDVPLNET 3 +DP + LQI NPDG+++R+LDIP P T P P S +P LSKD PLN T Sbjct: 15 VDPCEYLQIKRNPDGTITRFLDIPSTPAT---PDPSSPSPILSKDFPLNPT 62 >gb|EPS59852.1| hypothetical protein M569_14952, partial [Genlisea aurea] Length = 311 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = -3 Query: 152 DPYKLLQISLNPDGSLSRYLDIPIVPPTGENPSPDSSAPALSKDVPLN 9 DPY+ L ++LNPDG+L+R++ +P PPTGE+P+ LSKDV LN Sbjct: 1 DPYEHLNVALNPDGTLTRFIQLPTTPPTGEDPT-TPGLTVLSKDVTLN 47