BLASTX nr result
ID: Anemarrhena21_contig00007998
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00007998 (251 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCK92575.1| hypothetical protein BN164_2010001 [Peptoclostri... 68 2e-09 ref|XP_009016462.1| hypothetical protein HELRODRAFT_92462 [Helob... 57 4e-06 >emb|CCK92575.1| hypothetical protein BN164_2010001 [Peptoclostridium difficile T20] gi|549294130|emb|CCL04216.1| hypothetical protein BN167_2210004 [Peptoclostridium difficile E13] gi|549305793|emb|CCL16229.1| hypothetical protein BN170_2750004 [Peptoclostridium difficile T22] gi|549309795|emb|CCL20200.1| hypothetical protein BN171_3780006 [Peptoclostridium difficile E25] gi|549314204|emb|CCL24197.1| hypothetical protein BN172_5370005 [Clostridium difficile T15] gi|549318942|emb|CCL28114.1| hypothetical protein BN173_3630006 [Clostridium difficile T11] gi|549323434|emb|CCL32078.1| hypothetical protein BN174_3320006 [Clostridium difficile E15] gi|549331461|emb|CCL39945.1| hypothetical protein BN176_3220001 [Clostridium difficile E19] gi|549343452|emb|CCL51296.1| hypothetical protein BN179_3160001 [Clostridium difficile T6] gi|549351613|emb|CCL59294.1| hypothetical protein BN181_4300001 [Peptoclostridium difficile T17] gi|549355998|emb|CCL62934.1| hypothetical protein BN182_3110005 [Clostridium difficile E9] gi|549360368|emb|CCL66824.1| hypothetical protein BN183_3420001 [Clostridium difficile E7] gi|549368577|emb|CCL74467.1| hypothetical protein BN185_2650005 [Clostridium difficile E28] gi|549376332|emb|CCL82089.1| hypothetical protein BN187_3370001 [Clostridium difficile E12] gi|549388091|emb|CCL93467.1| hypothetical protein BN190_4910002 [Clostridium difficile T14] Length = 40 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -3 Query: 249 GAWPFLVGGVICLLNCDNERDLNLLNSGLYVALKNCWL 136 GAWPFLVGGVICLLNCDNERDLNLLNSG + CWL Sbjct: 4 GAWPFLVGGVICLLNCDNERDLNLLNSGASI----CWL 37 >ref|XP_009016462.1| hypothetical protein HELRODRAFT_92462 [Helobdella robusta] gi|555702204|gb|ESO05437.1| hypothetical protein HELRODRAFT_92462 [Helobdella robusta] Length = 77 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/72 (45%), Positives = 43/72 (59%), Gaps = 2/72 (2%) Frame = -3 Query: 249 GAWPFLVGGVICLLNCDNERDLNLLN--SGLYVALKNCWLIFLWGLSLLSKVEWSLGGLA 76 GAWPFLV GVICL+N DNERDL LLN + V L + +FL L LS+++ Sbjct: 4 GAWPFLVRGVICLVNSDNERDLILLNRQTNFLVGLSFGFSVFLEKLPALSRMKLGNNRSV 63 Query: 75 ISADISGQYRIT 40 + D+ G+ R T Sbjct: 64 MPLDVLGRTRAT 75