BLASTX nr result
ID: Anemarrhena21_contig00007979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00007979 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010097004.1| Pyrophosphate-energized vacuolar membrane pr... 117 3e-24 ref|XP_012444420.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_012474373.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_012474372.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_011073387.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_011017877.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_010913343.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_003632767.2| PREDICTED: LOW QUALITY PROTEIN: pyrophosphat... 117 3e-24 ref|XP_010654944.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 gb|KHG19866.1| Pyrophosphate-energized vacuolar membrane proton ... 117 3e-24 gb|KHG04918.1| Pyrophosphate-energized vacuolar membrane proton ... 117 3e-24 ref|XP_009796113.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_009628297.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_009403196.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_009401376.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_009338516.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_009334631.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_008372806.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_008228676.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 ref|XP_010050115.1| PREDICTED: pyrophosphate-energized vacuolar ... 117 3e-24 >ref|XP_010097004.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] gi|587877596|gb|EXB66631.1| Pyrophosphate-energized vacuolar membrane proton pump [Morus notabilis] Length = 764 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 708 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 764 >ref|XP_012444420.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Gossypium raimondii] gi|763786985|gb|KJB53981.1| hypothetical protein B456_009G014500 [Gossypium raimondii] Length = 770 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 714 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 770 >ref|XP_012474373.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump isoform X2 [Gossypium raimondii] gi|763756329|gb|KJB23660.1| hypothetical protein B456_004G108700 [Gossypium raimondii] Length = 667 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 611 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 667 >ref|XP_012474372.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump isoform X1 [Gossypium raimondii] gi|763756326|gb|KJB23657.1| hypothetical protein B456_004G108700 [Gossypium raimondii] gi|763756327|gb|KJB23658.1| hypothetical protein B456_004G108700 [Gossypium raimondii] Length = 771 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 715 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 771 >ref|XP_011073387.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Sesamum indicum] Length = 765 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 709 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >ref|XP_011017877.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Populus euphratica] Length = 768 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 712 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 768 >ref|XP_010913343.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Elaeis guineensis] Length = 765 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 709 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >ref|XP_003632767.2| PREDICTED: LOW QUALITY PROTEIN: pyrophosphate-energized vacuolar membrane proton pump [Vitis vinifera] Length = 444 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 388 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 444 >ref|XP_010654944.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Vitis vinifera] Length = 111 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 55 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 111 >gb|KHG19866.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium arboreum] Length = 771 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 715 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 771 >gb|KHG04918.1| Pyrophosphate-energized vacuolar membrane proton pump [Gossypium arboreum] Length = 770 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 714 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 770 >ref|XP_009796113.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Nicotiana sylvestris] Length = 765 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 709 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >ref|XP_009628297.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Nicotiana tomentosiformis] Length = 765 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 709 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 765 >ref|XP_009403196.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Musa acuminata subsp. malaccensis] Length = 763 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 707 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 763 >ref|XP_009401376.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Musa acuminata subsp. malaccensis] Length = 762 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 706 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 762 >ref|XP_009338516.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Pyrus x bretschneideri] Length = 767 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 711 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >ref|XP_009334631.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Pyrus x bretschneideri] Length = 767 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 711 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >ref|XP_008372806.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump-like [Malus domestica] Length = 1179 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 711 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >ref|XP_008228676.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Prunus mume] Length = 767 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 711 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 767 >ref|XP_010050115.1| PREDICTED: pyrophosphate-energized vacuolar membrane proton pump [Eucalyptus grandis] gi|629118322|gb|KCW82997.1| hypothetical protein EUGRSUZ_C04383 [Eucalyptus grandis] Length = 768 Score = 117 bits (293), Expect = 3e-24 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 300 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 130 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF Sbjct: 712 PKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHGGLLFKIF 768