BLASTX nr result
ID: Anemarrhena21_contig00007900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00007900 (640 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31026.3| unnamed protein product [Vitis vinifera] 92 3e-16 ref|XP_010098557.1| hypothetical protein L484_025999 [Morus nota... 82 2e-13 ref|XP_007214293.1| hypothetical protein PRUPE_ppb010966mg [Prun... 74 8e-11 >emb|CBI31026.3| unnamed protein product [Vitis vinifera] Length = 142 Score = 91.7 bits (226), Expect = 3e-16 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = +1 Query: 304 NSITALRKETRSIIRRGRECAQGFPKFLLASPSFHGGRGALPSAGGHPSDLT 459 N ITALRKE R I+RRG+E AQ FPKFL+ASPSFHGGRGALPSAGGHP+DLT Sbjct: 84 NFITALRKEIRIIVRRGKEDAQAFPKFLIASPSFHGGRGALPSAGGHPADLT 135 >ref|XP_010098557.1| hypothetical protein L484_025999 [Morus notabilis] gi|587886412|gb|EXB75217.1| hypothetical protein L484_025999 [Morus notabilis] Length = 167 Score = 82.0 bits (201), Expect = 2e-13 Identities = 41/57 (71%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Frame = +1 Query: 292 GWLHNSITALRKETRSI-IRRGRECAQGFPKFLLASPSFHGGRGALPSAGGHPSDLT 459 G L NS TALRKE + I RG++C Q PKFL+ASPSFHGGRGALPSAGGHP+DLT Sbjct: 104 GSLTNSTTALRKEVCAAKIGRGKQCRQASPKFLIASPSFHGGRGALPSAGGHPADLT 160 >ref|XP_007214293.1| hypothetical protein PRUPE_ppb010966mg [Prunus persica] gi|462410158|gb|EMJ15492.1| hypothetical protein PRUPE_ppb010966mg [Prunus persica] Length = 135 Score = 73.6 bits (179), Expect = 8e-11 Identities = 40/54 (74%), Positives = 43/54 (79%), Gaps = 2/54 (3%) Frame = +1 Query: 304 NSITALRKE-TRSI-IRRGRECAQGFPKFLLASPSFHGGRGALPSAGGHPSDLT 459 ++ITAL K TRSI I RGREC + F K L A PSFHGGRGALPSAGGHPSDLT Sbjct: 74 DAITALIKAITRSIKISRGRECMRAFSKSLFACPSFHGGRGALPSAGGHPSDLT 127