BLASTX nr result
ID: Anemarrhena21_contig00007213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00007213 (258 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010906441.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mit... 57 5e-06 ref|XP_010906439.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mit... 57 5e-06 ref|XP_008798538.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mit... 57 5e-06 >ref|XP_010906441.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mitochondrial-like isoform X2 [Elaeis guineensis] Length = 199 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/67 (49%), Positives = 42/67 (62%) Frame = -2 Query: 203 MAIARSSVLLGQFFHISQLPRLSLRIPTSVSTSTVRVPIGLGRIRCAASESGGGQNKVPA 24 MA RS++LL + H+S R S IP + +RV +G+G IRCAAS+SG G KV A Sbjct: 1 MAGIRSNLLLRELCHVSPFLRPSRTIPAIL----IRVHVGIGDIRCAASQSGDGDKKVSA 56 Query: 23 RLSKMHQ 3 RLS M Q Sbjct: 57 RLSMMQQ 63 >ref|XP_010906439.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mitochondrial-like isoform X1 [Elaeis guineensis] Length = 219 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/67 (49%), Positives = 42/67 (62%) Frame = -2 Query: 203 MAIARSSVLLGQFFHISQLPRLSLRIPTSVSTSTVRVPIGLGRIRCAASESGGGQNKVPA 24 MA RS++LL + H+S R S IP + +RV +G+G IRCAAS+SG G KV A Sbjct: 1 MAGIRSNLLLRELCHVSPFLRPSRTIPAIL----IRVHVGIGDIRCAASQSGDGDKKVSA 56 Query: 23 RLSKMHQ 3 RLS M Q Sbjct: 57 RLSMMQQ 63 >ref|XP_008798538.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mitochondrial-like [Phoenix dactylifera] gi|672157643|ref|XP_008798539.1| PREDICTED: peptidyl-tRNA hydrolase ICT1, mitochondrial-like [Phoenix dactylifera] Length = 219 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/67 (47%), Positives = 43/67 (64%) Frame = -2 Query: 203 MAIARSSVLLGQFFHISQLPRLSLRIPTSVSTSTVRVPIGLGRIRCAASESGGGQNKVPA 24 MA RS++LL + H+S+L R S IP +RV +G+G +RCAA++SG G KV A Sbjct: 1 MANIRSNLLLRELCHVSRLLRSSRTIPAV----PIRVHVGIGGVRCAAAQSGDGGKKVSA 56 Query: 23 RLSKMHQ 3 RLS M Q Sbjct: 57 RLSMMQQ 63