BLASTX nr result
ID: Anemarrhena21_contig00007145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00007145 (357 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008790187.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 56 8e-06 >ref|XP_008790187.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g30700 [Phoenix dactylifera] Length = 757 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/47 (61%), Positives = 34/47 (72%), Gaps = 8/47 (17%) Frame = -2 Query: 245 SSPPP--------RSFYLKLISTASSLSHFQQILAHSILTGRHPDLL 129 +SPPP RSFYL LIS AS+L H QILAH+IL+GRHPDL+ Sbjct: 11 TSPPPSPPSASAXRSFYLDLISGASTLRHLDQILAHAILSGRHPDLV 57