BLASTX nr result
ID: Anemarrhena21_contig00006678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00006678 (611 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088813.1| hypothetical protein L484_018375 [Morus nota... 57 7e-06 >ref|XP_010088813.1| hypothetical protein L484_018375 [Morus notabilis] gi|587846518|gb|EXB36996.1| hypothetical protein L484_018375 [Morus notabilis] Length = 110 Score = 57.0 bits (136), Expect = 7e-06 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = -2 Query: 577 MVMRSVLVRISPLSRSEASSLRISRCFSDGKGKVLSEEERAAENIYIQ 434 M MRSV+ R+ L+RS ++ +R SDGKG++LSEEERAAEN+YIQ Sbjct: 1 MAMRSVVRRVGILTRSMETTRGATRYLSDGKGRILSEEERAAENVYIQ 48