BLASTX nr result
ID: Anemarrhena21_contig00005360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00005360 (451 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010256665.1| PREDICTED: uncharacterized protein LOC104597... 72 1e-10 ref|XP_010275662.1| PREDICTED: AT-rich interactive domain-contai... 64 5e-08 ref|XP_010685617.1| PREDICTED: AT-rich interactive domain-contai... 63 7e-08 emb|CAN79179.1| hypothetical protein VITISV_016730 [Vitis vinifera] 62 1e-07 ref|XP_010650938.1| PREDICTED: AT-rich interactive domain-contai... 62 1e-07 ref|XP_002961062.1| hypothetical protein SELMODRAFT_28918, parti... 62 1e-07 ref|XP_010661854.1| PREDICTED: AT-rich interactive domain-contai... 61 3e-07 ref|XP_010661851.1| PREDICTED: AT-rich interactive domain-contai... 61 3e-07 ref|XP_010661850.1| PREDICTED: AT-rich interactive domain-contai... 61 3e-07 emb|CBI40441.3| unnamed protein product [Vitis vinifera] 61 3e-07 emb|CAN80959.1| hypothetical protein VITISV_037562 [Vitis vinifera] 61 3e-07 ref|XP_010255291.1| PREDICTED: AT-rich interactive domain-contai... 61 3e-07 ref|XP_006345587.1| PREDICTED: AT-rich interactive domain-contai... 60 6e-07 ref|XP_006345586.1| PREDICTED: AT-rich interactive domain-contai... 60 6e-07 ref|XP_002511884.1| DNA binding protein, putative [Ricinus commu... 59 1e-06 ref|XP_004240098.1| PREDICTED: AT-rich interactive domain-contai... 59 1e-06 ref|XP_009370208.1| PREDICTED: uncharacterized protein LOC103959... 59 1e-06 ref|XP_008352686.1| PREDICTED: AT-rich interactive domain-contai... 59 2e-06 ref|XP_008352685.1| PREDICTED: AT-rich interactive domain-contai... 59 2e-06 ref|XP_012083356.1| PREDICTED: AT-rich interactive domain-contai... 58 2e-06 >ref|XP_010256665.1| PREDICTED: uncharacterized protein LOC104597002 [Nelumbo nucifera] gi|720002390|ref|XP_010256666.1| PREDICTED: uncharacterized protein LOC104597002 [Nelumbo nucifera] gi|720002393|ref|XP_010256667.1| PREDICTED: uncharacterized protein LOC104597002 [Nelumbo nucifera] gi|720002396|ref|XP_010256668.1| PREDICTED: uncharacterized protein LOC104597002 [Nelumbo nucifera] gi|720002399|ref|XP_010256669.1| PREDICTED: uncharacterized protein LOC104597002 [Nelumbo nucifera] Length = 495 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/56 (60%), Positives = 43/56 (76%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP S G SFW+PAL+ F SK +K IVS+YFNVF+LR MS++TRL + DS DDE+ Sbjct: 408 NPPSRGKSFWKPALKRFQSKCKKSIVSYYFNVFILRRMSMQTRLVPEMADSDDDEA 463 >ref|XP_010275662.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Nelumbo nucifera] gi|720063501|ref|XP_010275663.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Nelumbo nucifera] Length = 607 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/56 (53%), Positives = 37/56 (66%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP S FW A + F +K+RKD+VS+YFNVFLLR S + R+ IDS DDES Sbjct: 514 NPPSLDKCFWNQAFKSFPTKKRKDLVSYYFNVFLLRRRSYQNRVSPNNIDSDDDES 569 >ref|XP_010685617.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Beta vulgaris subsp. vulgaris] gi|731348694|ref|XP_010685618.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Beta vulgaris subsp. vulgaris] gi|870853239|gb|KMT05120.1| hypothetical protein BVRB_7g172710 [Beta vulgaris subsp. vulgaris] Length = 241 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/76 (43%), Positives = 50/76 (65%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDESLRWE 268 NP S+G SF +PA+ F SK RKDIV++Y NV++ + +S+ +R G + +DS DDE + Sbjct: 150 NPLSQGKSFLQPAMSSFPSKTRKDIVNYYLNVYVPKRISLISRSGCKVLDSDDDEVVEAP 209 Query: 267 *NKNAKHEPHIRRMRS 220 NAK+ ++R RS Sbjct: 210 NTPNAKNS--LKRSRS 223 >emb|CAN79179.1| hypothetical protein VITISV_016730 [Vitis vinifera] Length = 242 Score = 62.4 bits (150), Expect = 1e-07 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDE 283 +P S+ SF +PA+E F SK RKDIVS+Y NVF+ R +S TR G +TIDS DDE Sbjct: 153 HPPSQHKSFLKPAIEXFPSKSRKDIVSYYCNVFVPRRISKLTRAGCKTIDSDDDE 207 >ref|XP_010650938.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Vitis vinifera] gi|731391952|ref|XP_010650939.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Vitis vinifera] Length = 242 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDE 283 +P S+ SF +PA+E F SK RKDIVS+Y NVF+ R +S TR G +TIDS DDE Sbjct: 153 HPPSQHKSFLKPAIEAFPSKSRKDIVSYYCNVFVPRRISKLTRAGCKTIDSDDDE 207 >ref|XP_002961062.1| hypothetical protein SELMODRAFT_28918, partial [Selaginella moellendorffii] gi|302767050|ref|XP_002966945.1| hypothetical protein SELMODRAFT_18945, partial [Selaginella moellendorffii] gi|300164936|gb|EFJ31544.1| hypothetical protein SELMODRAFT_18945, partial [Selaginella moellendorffii] gi|300172001|gb|EFJ38601.1| hypothetical protein SELMODRAFT_28918, partial [Selaginella moellendorffii] Length = 92 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/56 (46%), Positives = 40/56 (71%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP+S+ +FW P F S+RR+++VS+YFNVF+LR +++ R + +DS DDES Sbjct: 33 NPASQRRNFWTPLRYAFPSRRRRELVSYYFNVFVLRRRALQNRFDRENVDSDDDES 88 >ref|XP_010661854.1| PREDICTED: AT-rich interactive domain-containing protein 1 isoform X3 [Vitis vinifera] Length = 621 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP S G+ FW+ + F++K R+D+VS+YFNVFLL+ + + RL IDS DDES Sbjct: 534 NPPSMGVRFWDEIFKSFSTKSREDLVSYYFNVFLLQRRADQNRLTPNNIDSDDDES 589 >ref|XP_010661851.1| PREDICTED: AT-rich interactive domain-containing protein 1 isoform X2 [Vitis vinifera] gi|731421731|ref|XP_010661852.1| PREDICTED: AT-rich interactive domain-containing protein 1 isoform X2 [Vitis vinifera] gi|731421733|ref|XP_010661853.1| PREDICTED: AT-rich interactive domain-containing protein 1 isoform X2 [Vitis vinifera] Length = 626 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP S G+ FW+ + F++K R+D+VS+YFNVFLL+ + + RL IDS DDES Sbjct: 539 NPPSMGVRFWDEIFKSFSTKSREDLVSYYFNVFLLQRRADQNRLTPNNIDSDDDES 594 >ref|XP_010661850.1| PREDICTED: AT-rich interactive domain-containing protein 1 isoform X1 [Vitis vinifera] Length = 633 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP S G+ FW+ + F++K R+D+VS+YFNVFLL+ + + RL IDS DDES Sbjct: 546 NPPSMGVRFWDEIFKSFSTKSREDLVSYYFNVFLLQRRADQNRLTPNNIDSDDDES 601 >emb|CBI40441.3| unnamed protein product [Vitis vinifera] Length = 594 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP S G+ FW+ + F++K R+D+VS+YFNVFLL+ + + RL IDS DDES Sbjct: 505 NPPSMGVRFWDEIFKSFSTKSREDLVSYYFNVFLLQRRADQNRLTPNNIDSDDDES 560 >emb|CAN80959.1| hypothetical protein VITISV_037562 [Vitis vinifera] Length = 724 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/56 (50%), Positives = 39/56 (69%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP S G+ FW+ + F++K R+D+VS+YFNVFLL+ + + RL IDS DDES Sbjct: 539 NPPSMGVRFWDEIFKSFSTKSREDLVSYYFNVFLLQRRADQNRLTPNNIDSDDDES 594 >ref|XP_010255291.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X1 [Nelumbo nucifera] gi|719998050|ref|XP_010255292.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X1 [Nelumbo nucifera] gi|719998053|ref|XP_010255293.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X1 [Nelumbo nucifera] gi|719998056|ref|XP_010255295.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X2 [Nelumbo nucifera] Length = 611 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/56 (50%), Positives = 38/56 (67%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP S FW+ A + F +K+R+D+VS+YFNVF+LR S + R+ IDS DDES Sbjct: 516 NPPSLDKCFWDQAFKSFPTKKRRDLVSYYFNVFVLRRRSYQNRVTPTNIDSDDDES 571 >ref|XP_006345587.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X2 [Solanum tuberosum] Length = 618 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP SE SFW+ ++F +K R+ +VS+YFNVFLLR + + R IDS DDES Sbjct: 531 NPLSEEKSFWDEVFKFFPNKSRESLVSYYFNVFLLRRRANQNRTNAGNIDSDDDES 586 >ref|XP_006345586.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X1 [Solanum tuberosum] Length = 621 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/56 (50%), Positives = 37/56 (66%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP SE SFW+ ++F +K R+ +VS+YFNVFLLR + + R IDS DDES Sbjct: 534 NPLSEEKSFWDEVFKFFPNKSRESLVSYYFNVFLLRRRANQNRTNAGNIDSDDDES 589 >ref|XP_002511884.1| DNA binding protein, putative [Ricinus communis] gi|223549064|gb|EEF50553.1| DNA binding protein, putative [Ricinus communis] Length = 279 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/56 (46%), Positives = 38/56 (67%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP S FW+ ++F++KRR+D+VS+YFNVFL++ + + R IDS DDES Sbjct: 192 NPPSLDKCFWDEIFKFFSTKRREDLVSYYFNVFLMQRRAHQNRFTPNNIDSDDDES 247 >ref|XP_004240098.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Solanum lycopersicum] Length = 617 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/56 (50%), Positives = 36/56 (64%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP SE SFW ++F +K R+ +VS+YFNVFLLR + + R IDS DDES Sbjct: 528 NPLSEEKSFWNEVFKFFPNKSRESLVSYYFNVFLLRRRANQNRTNAGNIDSDDDES 583 >ref|XP_009370208.1| PREDICTED: uncharacterized protein LOC103959585 [Pyrus x bretschneideri] Length = 473 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/56 (48%), Positives = 39/56 (69%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP S SFW+ A + F SK RK+I+++Y+NV++ R MS++TR IDS DDE+ Sbjct: 416 NPLSNEASFWKIAYKRFPSKSRKNILNYYYNVYIPRRMSLQTRSSSDEIDSDDDEA 471 >ref|XP_008352686.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X2 [Malus domestica] Length = 545 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDE 283 NPSS G+ FW+ + FT K R+++VS+YFNVFLL+ + R IDS D+E Sbjct: 458 NPSSLGLRFWDEIYKTFTKKSRRELVSYYFNVFLLQRRGYQNRFTPNNIDSDDEE 512 >ref|XP_008352685.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X1 [Malus domestica] Length = 695 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/55 (47%), Positives = 36/55 (65%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDE 283 NPSS G+ FW+ + FT K R+++VS+YFNVFLL+ + R IDS D+E Sbjct: 608 NPSSLGLRFWDEIYKTFTKKSRRELVSYYFNVFLLQRRGYQNRFTPNNIDSDDEE 662 >ref|XP_012083356.1| PREDICTED: AT-rich interactive domain-containing protein 1 isoform X2 [Jatropha curcas] Length = 644 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/56 (46%), Positives = 37/56 (66%) Frame = -2 Query: 447 NPSSEGMSFWEPALEYFTSKRRKDIVSFYFNVFLLRWMSIRTRLGDQTIDSSDDES 280 NP S FW+ ++F ++RR+D+VS+YFNVFLL+ + + R IDS DDES Sbjct: 557 NPPSLDKCFWDEMFKFFPTRRREDLVSYYFNVFLLQRRAHQNRFTPNNIDSDDDES 612