BLASTX nr result
ID: Anemarrhena21_contig00003156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00003156 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009414098.1| PREDICTED: glutamate decarboxylase 5-like is... 68 2e-09 ref|XP_009408402.1| PREDICTED: glutamate decarboxylase-like [Mus... 67 4e-09 ref|XP_006849524.1| PREDICTED: glutamate decarboxylase [Amborell... 66 8e-09 gb|KJB50409.1| hypothetical protein B456_008G169300 [Gossypium r... 65 1e-08 ref|XP_012438388.1| PREDICTED: glutamate decarboxylase [Gossypiu... 65 1e-08 gb|KHG13427.1| Glutamate decarboxylase 1 -like protein [Gossypiu... 65 1e-08 ref|XP_010276236.1| PREDICTED: glutamate decarboxylase-like [Nel... 65 1e-08 ref|XP_012074739.1| PREDICTED: glutamate decarboxylase 1 [Jatrop... 65 2e-08 ref|XP_002318327.1| pyridoxal-dependent decarboxylase family pro... 65 2e-08 ref|XP_009129180.1| PREDICTED: glutamate decarboxylase 4 [Brassi... 65 2e-08 ref|XP_008463152.1| PREDICTED: glutamate decarboxylase 1 [Cucumi... 65 2e-08 ref|XP_010069480.1| PREDICTED: glutamate decarboxylase-like [Euc... 65 2e-08 ref|XP_006290959.1| hypothetical protein CARUB_v10017075mg, part... 65 2e-08 ref|XP_010043901.1| PREDICTED: glutamate decarboxylase 4 [Eucaly... 64 3e-08 ref|XP_009780824.1| PREDICTED: glutamate decarboxylase [Nicotian... 64 3e-08 gb|KCW85921.1| hypothetical protein EUGRSUZ_B02632 [Eucalyptus g... 64 3e-08 ref|XP_002527680.1| glutamate decarboxylase, putative [Ricinus c... 64 3e-08 gb|AAB40608.1| glutamate decarboxylase [Nicotiana tabacum] 64 3e-08 ref|XP_009631358.1| PREDICTED: glutamate decarboxylase [Nicotian... 64 3e-08 gb|AAK18620.1|AF352732_1 glutamate decarboxylase isozyme 1 [Nico... 64 3e-08 >ref|XP_009414098.1| PREDICTED: glutamate decarboxylase 5-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 499 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 M V+TT+ DTGESLHSTFASRYVR SLPRF++P SIPK+A Sbjct: 1 MAVTTTKLDTGESLHSTFASRYVRASLPRFRIPEQSIPKDA 41 >ref|XP_009408402.1| PREDICTED: glutamate decarboxylase-like [Musa acuminata subsp. malaccensis] Length = 499 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MVV+TTR DTGE L+ TFASRYVR SLPRFK+P SIPKEA Sbjct: 1 MVVTTTRVDTGEPLYCTFASRYVRASLPRFKMPEQSIPKEA 41 >ref|XP_006849524.1| PREDICTED: glutamate decarboxylase [Amborella trichopoda] gi|548853099|gb|ERN11105.1| hypothetical protein AMTR_s00024p00151670 [Amborella trichopoda] Length = 498 Score = 66.2 bits (160), Expect = 8e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+ST D G++LH TFASRYVRTSLPRFK+P NSIPK+A Sbjct: 1 MVISTAIADAGQALHCTFASRYVRTSLPRFKMPENSIPKDA 41 >gb|KJB50409.1| hypothetical protein B456_008G169300 [Gossypium raimondii] Length = 372 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S T ++T S+HSTFASRYVRTSLPRFK+P NSIPKEA Sbjct: 1 MVLSKTASETDVSVHSTFASRYVRTSLPRFKMPENSIPKEA 41 >ref|XP_012438388.1| PREDICTED: glutamate decarboxylase [Gossypium raimondii] gi|763783337|gb|KJB50408.1| hypothetical protein B456_008G169300 [Gossypium raimondii] Length = 499 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S T ++T S+HSTFASRYVRTSLPRFK+P NSIPKEA Sbjct: 1 MVLSKTASETDVSVHSTFASRYVRTSLPRFKMPENSIPKEA 41 >gb|KHG13427.1| Glutamate decarboxylase 1 -like protein [Gossypium arboreum] Length = 499 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S T ++T S+HSTFASRYVRTSLPRFK+P NSIPKEA Sbjct: 1 MVLSKTASETDVSVHSTFASRYVRTSLPRFKMPENSIPKEA 41 >ref|XP_010276236.1| PREDICTED: glutamate decarboxylase-like [Nelumbo nucifera] Length = 495 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MVVS+T TD+ E++ STFASRYVRTSLPRFK+P SIPKEA Sbjct: 1 MVVSSTATDSSENVQSTFASRYVRTSLPRFKMPEQSIPKEA 41 >ref|XP_012074739.1| PREDICTED: glutamate decarboxylase 1 [Jatropha curcas] gi|643727208|gb|KDP35742.1| hypothetical protein JCGZ_10514 [Jatropha curcas] Length = 493 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S +D+ +S+HSTFASRYVRTSLPRFK+P NSIPKEA Sbjct: 1 MVLSRAASDSDDSVHSTFASRYVRTSLPRFKMPENSIPKEA 41 >ref|XP_002318327.1| pyridoxal-dependent decarboxylase family protein [Populus trichocarpa] gi|222859000|gb|EEE96547.1| pyridoxal-dependent decarboxylase family protein [Populus trichocarpa] Length = 501 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+ST TD+ E+L+STFASRYVRT+LPRFK+P NS+PK+A Sbjct: 1 MVISTAATDSDENLYSTFASRYVRTALPRFKMPENSMPKDA 41 >ref|XP_009129180.1| PREDICTED: glutamate decarboxylase 4 [Brassica rapa] Length = 493 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S T ++T S+HSTFASRYVRTSLPRF++P NSIPKEA Sbjct: 1 MVLSKTASETDASIHSTFASRYVRTSLPRFEMPENSIPKEA 41 >ref|XP_008463152.1| PREDICTED: glutamate decarboxylase 1 [Cucumis melo] Length = 499 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S T + T S+HSTFASRYVRTSLPRFK+P NSIPKEA Sbjct: 1 MVLSKTASQTDVSVHSTFASRYVRTSLPRFKMPENSIPKEA 41 >ref|XP_010069480.1| PREDICTED: glutamate decarboxylase-like [Eucalyptus grandis] gi|629091847|gb|KCW57842.1| hypothetical protein EUGRSUZ_H00595 [Eucalyptus grandis] Length = 499 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MVV+TT +D+ ES+HSTFASRYVR SLP+FK+P SIPKEA Sbjct: 1 MVVTTTVSDSDESIHSTFASRYVRNSLPKFKMPEQSIPKEA 41 >ref|XP_006290959.1| hypothetical protein CARUB_v10017075mg, partial [Capsella rubella] gi|482559666|gb|EOA23857.1| hypothetical protein CARUB_v10017075mg, partial [Capsella rubella] Length = 498 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = -2 Query: 130 KKMVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 KKMV+S T +++ S+HSTFASRYVR SLPRF++P NSIPKEA Sbjct: 7 KKMVLSKTASESDVSIHSTFASRYVRNSLPRFEMPENSIPKEA 49 >ref|XP_010043901.1| PREDICTED: glutamate decarboxylase 4 [Eucalyptus grandis] Length = 500 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S T +++ S+HSTFASRYVRTSLPRFK+P NSIPKEA Sbjct: 1 MVLSKTASESDVSIHSTFASRYVRTSLPRFKMPENSIPKEA 41 >ref|XP_009780824.1| PREDICTED: glutamate decarboxylase [Nicotiana sylvestris] Length = 496 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S T +++ S+HSTFASRYVRTSLPRFK+P NSIPKEA Sbjct: 1 MVLSKTASESDVSIHSTFASRYVRTSLPRFKMPENSIPKEA 41 >gb|KCW85921.1| hypothetical protein EUGRSUZ_B02632 [Eucalyptus grandis] Length = 560 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S T +++ S+HSTFASRYVRTSLPRFK+P NSIPKEA Sbjct: 61 MVLSKTASESDVSIHSTFASRYVRTSLPRFKMPENSIPKEA 101 >ref|XP_002527680.1| glutamate decarboxylase, putative [Ricinus communis] gi|223532911|gb|EEF34679.1| glutamate decarboxylase, putative [Ricinus communis] Length = 529 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+STT TD+ E LHSTFASRYVRT +PRFK+P S+PKEA Sbjct: 40 MVISTTITDSDEVLHSTFASRYVRTPVPRFKMPEKSMPKEA 80 >gb|AAB40608.1| glutamate decarboxylase [Nicotiana tabacum] Length = 496 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S T +++ S+HSTFASRYVRTSLPRFK+P NSIPKEA Sbjct: 1 MVLSKTASESDVSIHSTFASRYVRTSLPRFKMPENSIPKEA 41 >ref|XP_009631358.1| PREDICTED: glutamate decarboxylase [Nicotiana tomentosiformis] gi|3252856|gb|AAC24195.1| glutamate decarboxylase isozyme 1 [Nicotiana tabacum] Length = 496 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S T +++ S+HSTFASRYVRTSLPRFK+P NSIPKEA Sbjct: 1 MVLSKTASESDVSIHSTFASRYVRTSLPRFKMPENSIPKEA 41 >gb|AAK18620.1|AF352732_1 glutamate decarboxylase isozyme 1 [Nicotiana tabacum] Length = 496 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -2 Query: 124 MVVSTTRTDTGESLHSTFASRYVRTSLPRFKLPANSIPKEA 2 MV+S T +++ S+HSTFASRYVRTSLPRFK+P NSIPKEA Sbjct: 1 MVLSKTASESDVSIHSTFASRYVRTSLPRFKMPENSIPKEA 41