BLASTX nr result
ID: Anemarrhena21_contig00003090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00003090 (394 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010909027.1| PREDICTED: cysteine proteinase inhibitor 6-l... 78 2e-12 ref|XP_008795132.1| PREDICTED: cysteine proteinase inhibitor 12 ... 77 4e-12 ref|XP_010244435.1| PREDICTED: cysteine proteinase inhibitor 12-... 77 6e-12 ref|XP_009394088.1| PREDICTED: cysteine proteinase inhibitor 12-... 76 8e-12 gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasi... 75 2e-11 ref|XP_006836222.2| PREDICTED: cysteine proteinase inhibitor 6 i... 74 4e-11 gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Ambore... 74 4e-11 ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago trun... 74 5e-11 gb|AFK41721.1| unknown [Lotus japonicus] 73 6e-11 gb|KHN37731.1| Cysteine proteinase inhibitor 12 [Glycine soja] 72 1e-10 gb|KHN11196.1| Cysteine proteinase inhibitor 12 [Glycine soja] 72 1e-10 ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Gly... 72 1e-10 gb|ACU24145.1| unknown [Glycine max] 72 1e-10 ref|XP_012068733.1| PREDICTED: cysteine proteinase inhibitor 6 [... 72 1e-10 ref|XP_010938907.1| PREDICTED: cysteine proteinase inhibitor 12-... 72 1e-10 gb|KDP40574.1| hypothetical protein JCGZ_24573 [Jatropha curcas] 72 1e-10 ref|XP_008445944.1| PREDICTED: cysteine proteinase inhibitor 12 ... 72 2e-10 ref|XP_007133641.1| hypothetical protein PHAVU_011G196600g [Phas... 72 2e-10 gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa] 72 2e-10 ref|XP_004511090.1| PREDICTED: cysteine proteinase inhibitor 6 [... 72 2e-10 >ref|XP_010909027.1| PREDICTED: cysteine proteinase inhibitor 6-like [Elaeis guineensis] Length = 243 Score = 78.2 bits (191), Expect = 2e-12 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQ 214 EVIED AKFDLLLK+KRGS EEK KVEVHKN+EGTFHLNKMQ+ Sbjct: 195 EVIEDSAKFDLLLKLKRGSKEEKLKVEVHKNLEGTFHLNKMQE 237 >ref|XP_008795132.1| PREDICTED: cysteine proteinase inhibitor 12 [Phoenix dactylifera] Length = 242 Score = 77.0 bits (188), Expect = 4e-12 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQ 214 EVIED AKFDLLL++KRGS EEK KVEVHKN+EGTFHLNKMQ+ Sbjct: 194 EVIEDSAKFDLLLRLKRGSKEEKLKVEVHKNLEGTFHLNKMQE 236 >ref|XP_010244435.1| PREDICTED: cysteine proteinase inhibitor 12-like [Nelumbo nucifera] Length = 239 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 EVIE++AKFDLLLKVKRG+ EEK+KVEVHKN+EG FHLN M+QD Sbjct: 194 EVIEEVAKFDLLLKVKRGNKEEKFKVEVHKNVEGIFHLNMMEQD 237 >ref|XP_009394088.1| PREDICTED: cysteine proteinase inhibitor 12-like [Musa acuminata subsp. malaccensis] Length = 164 Score = 76.3 bits (186), Expect = 8e-12 Identities = 33/44 (75%), Positives = 42/44 (95%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 +V+ED+AKFD+L+KVKRGS EEK KVEVHK++EGTFHLN+MQQ+ Sbjct: 114 QVVEDIAKFDMLIKVKRGSKEEKLKVEVHKDLEGTFHLNQMQQE 157 >gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasia esculenta] Length = 205 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 +V+EDLAK LLLK+KRGS EEK+KVEVHKN+EGTFHLN+M+QD Sbjct: 156 KVLEDLAKIHLLLKLKRGSREEKFKVEVHKNIEGTFHLNQMEQD 199 >ref|XP_006836222.2| PREDICTED: cysteine proteinase inhibitor 6 isoform X1 [Amborella trichopoda] Length = 225 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQ 214 EVIE+ AKFD+LLK+KRG+ EEKYKVEVHKN+EG++HLN MQQ Sbjct: 175 EVIEESAKFDMLLKLKRGNKEEKYKVEVHKNLEGSYHLNHMQQ 217 >gb|ERM99075.1| hypothetical protein AMTR_s00101p00100170 [Amborella trichopoda] Length = 206 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/43 (76%), Positives = 40/43 (93%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQ 214 EVIE+ AKFD+LLK+KRG+ EEKYKVEVHKN+EG++HLN MQQ Sbjct: 156 EVIEESAKFDMLLKLKRGNKEEKYKVEVHKNLEGSYHLNHMQQ 198 >ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago truncatula] gi|355522035|gb|AET02489.1| cysteine protease inhibitor cystatin [Medicago truncatula] Length = 241 Score = 73.6 bits (179), Expect = 5e-11 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = -2 Query: 357 TTALDEVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 T A EVI+D AKF+LLLKVKRG EEK+KVEVHKN EG FHLN+M+ D Sbjct: 191 TDAKAEVIDDTAKFNLLLKVKRGQKEEKFKVEVHKNSEGNFHLNQMEAD 239 >gb|AFK41721.1| unknown [Lotus japonicus] Length = 237 Score = 73.2 bits (178), Expect = 6e-11 Identities = 32/44 (72%), Positives = 41/44 (93%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 EVI+D+AKF++LLK+KRG EEK+KVEVHKN EG+FHLN+M+QD Sbjct: 192 EVIDDVAKFNILLKLKRGEKEEKFKVEVHKNNEGSFHLNQMEQD 235 >gb|KHN37731.1| Cysteine proteinase inhibitor 12 [Glycine soja] Length = 245 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 EVI+D AKF+LLLKVKRG EEK+KVEVHKN +G FHLN+M+QD Sbjct: 200 EVIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQD 243 >gb|KHN11196.1| Cysteine proteinase inhibitor 12 [Glycine soja] Length = 245 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 EVI+D AKF+LLLKVKRG EEK+KVEVHKN +G FHLN+M+QD Sbjct: 200 EVIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQD 243 >ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Glycine max] gi|1944319|dbj|BAA19608.1| cysteine proteinase inhibitor [Glycine max] gi|1944342|dbj|BAA19610.1| cysteine proteinase inhibitor [Glycine max] Length = 245 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 EVI+D AKF+LLLKVKRG EEK+KVEVHKN +G FHLN+M+QD Sbjct: 200 EVIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQD 243 >gb|ACU24145.1| unknown [Glycine max] Length = 245 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 EVI+D AKF+LLLKVKRG EEK+KVEVHKN +G FHLN+M+QD Sbjct: 200 EVIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQD 243 >ref|XP_012068733.1| PREDICTED: cysteine proteinase inhibitor 6 [Jatropha curcas] Length = 242 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQ 217 EV++D AKFD+LLKVKRGSNEEKYKVEVHKN EG F LN+M+ Sbjct: 198 EVVDDFAKFDMLLKVKRGSNEEKYKVEVHKNNEGNFLLNQME 239 >ref|XP_010938907.1| PREDICTED: cysteine proteinase inhibitor 12-like [Elaeis guineensis] Length = 200 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQ 217 EVIED AK+DLLLK+KRGS EEK+KVEVH+N+E TFHLN+MQ Sbjct: 152 EVIEDSAKYDLLLKLKRGSKEEKFKVEVHRNLECTFHLNRMQ 193 >gb|KDP40574.1| hypothetical protein JCGZ_24573 [Jatropha curcas] Length = 205 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQ 217 EV++D AKFD+LLKVKRGSNEEKYKVEVHKN EG F LN+M+ Sbjct: 161 EVVDDFAKFDMLLKVKRGSNEEKYKVEVHKNNEGNFLLNQME 202 >ref|XP_008445944.1| PREDICTED: cysteine proteinase inhibitor 12 [Cucumis melo] Length = 250 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/44 (79%), Positives = 38/44 (86%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 EVIED AKFDLLLK+KRGS EEK+KVEVHKN EG F LN+M QD Sbjct: 205 EVIEDAAKFDLLLKLKRGSKEEKFKVEVHKNNEGNFLLNQMVQD 248 >ref|XP_007133641.1| hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris] gi|561006641|gb|ESW05635.1| hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris] Length = 246 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -2 Query: 357 TTALDEVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 T A EV++D AKF+LLLKVKRG EEK+KVEVHKN +G HLN+M+QD Sbjct: 196 TDAKAEVVDDFAKFNLLLKVKRGEKEEKFKVEVHKNNQGELHLNQMEQD 244 >gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa] Length = 228 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/44 (75%), Positives = 39/44 (88%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 EVIE+ AKFD+LLKVKRGS EEK+K EVHKN+EG F LN+MQQ+ Sbjct: 184 EVIEETAKFDMLLKVKRGSKEEKFKAEVHKNLEGNFLLNQMQQE 227 >ref|XP_004511090.1| PREDICTED: cysteine proteinase inhibitor 6 [Cicer arietinum] Length = 247 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/44 (72%), Positives = 40/44 (90%) Frame = -2 Query: 342 EVIEDLAKFDLLLKVKRGSNEEKYKVEVHKNMEGTFHLNKMQQD 211 EVI+D+A F+LLLK+KRG+ EEK+KVEVHKN EGTFHLN+M+ D Sbjct: 202 EVIDDVANFNLLLKLKRGAKEEKFKVEVHKNNEGTFHLNQMEAD 245