BLASTX nr result
ID: Anemarrhena21_contig00001643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00001643 (522 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008244252.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-4 [P... 58 3e-06 ref|XP_007202951.1| hypothetical protein PRUPE_ppa014928mg [Prun... 58 3e-06 >ref|XP_008244252.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-4 [Prunus mume] Length = 1040 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 184 AAHRHFQAVTWLETILGPFELPLEPAEKEFISCLRSGM 71 AA R FQAV WLET++GP +P +P+E+EFISCLR+G+ Sbjct: 22 AAWRRFQAVEWLETLVGPLGIPKQPSEREFISCLRNGL 59 >ref|XP_007202951.1| hypothetical protein PRUPE_ppa014928mg [Prunus persica] gi|462398482|gb|EMJ04150.1| hypothetical protein PRUPE_ppa014928mg [Prunus persica] Length = 284 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 184 AAHRHFQAVTWLETILGPFELPLEPAEKEFISCLRSGM 71 AA R FQAV WLET++GP +P +P+E+EFISCLR+G+ Sbjct: 22 AAWRRFQAVEWLETLVGPLGIPKQPSEREFISCLRNGL 59