BLASTX nr result
ID: Anemarrhena21_contig00001529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00001529 (482 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACR45959.1| glutamine synthetase 1a [Lolium perenne] 187 2e-45 pdb|2D3A|A Chain A, Crystal Structure Of The Maize Glutamine Syn... 186 5e-45 gb|ACB06727.1| glutamine synthetase [Zea mays] 186 5e-45 ref|NP_001105444.1| glutamine synthetase root isozyme 4 [Zea may... 186 5e-45 gb|AFW63835.1| glutamine synthetase5 [Zea mays] 186 5e-45 gb|ACR38147.1| unknown [Zea mays] gi|413923904|gb|AFW63836.1| gl... 186 5e-45 ref|XP_010909363.1| PREDICTED: glutamine synthetase nodule isozy... 186 7e-45 ref|XP_008812466.1| PREDICTED: glutamine synthetase nodule isozy... 186 7e-45 dbj|BAK01909.1| predicted protein [Hordeum vulgare subsp. vulgar... 185 1e-44 ref|XP_008775534.1| PREDICTED: glutamine synthetase nodule isozy... 184 2e-44 gb|AFP20991.1| glutamine synthetase isozyme [Zea mays] 184 2e-44 ref|XP_010932552.1| PREDICTED: glutamine synthetase nodule isozy... 184 3e-44 ref|XP_010916212.1| PREDICTED: glutamine synthetase nodule isozy... 184 3e-44 gb|AFB69879.1| glutamine synthetase isoform 1-1 [Secale cereale] 184 3e-44 ref|XP_009393673.1| PREDICTED: glutamine synthetase nodule isozy... 183 3e-44 ref|NP_001105296.1| glutamine synthetase root isozyme 3 [Zea may... 183 4e-44 gb|ACA50923.1| glutamine synthetase [Zea mays] 183 4e-44 sp|P38561.1|GLNA3_MAIZE RecName: Full=Glutamine synthetase root ... 183 4e-44 ref|XP_010236151.1| PREDICTED: glutamine synthetase cytosolic is... 183 4e-44 gb|AAW21273.1| glutamine synthetase [Saccharum officinarum] 183 4e-44 >gb|ACR45959.1| glutamine synthetase 1a [Lolium perenne] Length = 356 Score = 187 bits (475), Expect = 2e-45 Identities = 88/92 (95%), Positives = 89/92 (96%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTLPG VS PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >pdb|2D3A|A Chain A, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490285|pdb|2D3A|B Chain B, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490286|pdb|2D3A|C Chain C, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490287|pdb|2D3A|D Chain D, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490288|pdb|2D3A|E Chain E, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490289|pdb|2D3A|F Chain F, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490290|pdb|2D3A|G Chain G, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490291|pdb|2D3A|H Chain H, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490292|pdb|2D3A|I Chain I, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490293|pdb|2D3A|J Chain J, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Methionine Sulfoximine Phosphate gi|112490296|pdb|2D3B|A Chain A, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490297|pdb|2D3B|B Chain B, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490298|pdb|2D3B|C Chain C, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490299|pdb|2D3B|D Chain D, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490300|pdb|2D3B|E Chain E, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490301|pdb|2D3B|F Chain F, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490302|pdb|2D3B|G Chain G, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490303|pdb|2D3B|H Chain H, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490304|pdb|2D3B|I Chain I, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490305|pdb|2D3B|J Chain J, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Amppnp And Methionine Sulfoximine gi|112490309|pdb|2D3C|A Chain A, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490310|pdb|2D3C|B Chain B, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490311|pdb|2D3C|C Chain C, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490312|pdb|2D3C|D Chain D, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490313|pdb|2D3C|E Chain E, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490314|pdb|2D3C|F Chain F, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490315|pdb|2D3C|G Chain G, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490316|pdb|2D3C|H Chain H, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490317|pdb|2D3C|I Chain I, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|112490318|pdb|2D3C|J Chain J, Crystal Structure Of The Maize Glutamine Synthetase Complexed With Adp And Phosphinothricin Phosphate gi|286122|dbj|BAA03430.1| glutamine synthetase [Zea mays] Length = 356 Score = 186 bits (472), Expect = 5e-45 Identities = 87/92 (94%), Positives = 89/92 (96%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTLPG V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >gb|ACB06727.1| glutamine synthetase [Zea mays] Length = 356 Score = 186 bits (472), Expect = 5e-45 Identities = 87/92 (94%), Positives = 89/92 (96%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTLPG V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >ref|NP_001105444.1| glutamine synthetase root isozyme 4 [Zea mays] gi|585204|sp|P38562.1|GLNA4_MAIZE RecName: Full=Glutamine synthetase root isozyme 4; AltName: Full=GS107; AltName: Full=Glutamate--ammonia ligase gi|434330|emb|CAA46722.1| glutamine synthetase [Zea mays] Length = 355 Score = 186 bits (472), Expect = 5e-45 Identities = 87/92 (94%), Positives = 89/92 (96%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTLPG V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >gb|AFW63835.1| glutamine synthetase5 [Zea mays] Length = 309 Score = 186 bits (472), Expect = 5e-45 Identities = 87/92 (94%), Positives = 89/92 (96%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTLPG V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >gb|ACR38147.1| unknown [Zea mays] gi|413923904|gb|AFW63836.1| glutamine synthetase5 [Zea mays] Length = 356 Score = 186 bits (472), Expect = 5e-45 Identities = 87/92 (94%), Positives = 89/92 (96%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTLPG V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >ref|XP_010909363.1| PREDICTED: glutamine synthetase nodule isozyme [Elaeis guineensis] Length = 356 Score = 186 bits (471), Expect = 7e-45 Identities = 87/92 (94%), Positives = 89/92 (96%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 T+KIIAEYIWIGGSGMDIRSKARTLPG V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TDKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >ref|XP_008812466.1| PREDICTED: glutamine synthetase nodule isozyme [Phoenix dactylifera] Length = 356 Score = 186 bits (471), Expect = 7e-45 Identities = 87/92 (94%), Positives = 89/92 (96%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 T+KIIAEYIWIGGSGMDIRSKARTLPG V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TDKIIAEYIWIGGSGMDIRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >dbj|BAK01909.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|417356959|gb|AFX60875.1| glutamine synthetase isoform GS1_1 [Hordeum vulgare] gi|578897548|gb|AHI17510.1| cytosolic glutamine synthetase 1 [Hordeum vulgare subsp. vulgare] gi|578897550|gb|AHI17511.1| cytosolic glutamine synthetase 1 [Hordeum vulgare subsp. vulgare] Length = 356 Score = 185 bits (469), Expect = 1e-44 Identities = 86/92 (93%), Positives = 89/92 (96%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTLPG V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFR+GNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRKGNNILVMCDCYTPAGEPIPTNKR 107 >ref|XP_008775534.1| PREDICTED: glutamine synthetase nodule isozyme-like [Phoenix dactylifera] Length = 359 Score = 184 bits (468), Expect = 2e-44 Identities = 87/92 (94%), Positives = 88/92 (95%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIW+GGSGMDIRSKARTLP VS PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 19 TEKIIAEYIWVGGSGMDIRSKARTLPEPVSDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 78 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 79 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 110 >gb|AFP20991.1| glutamine synthetase isozyme [Zea mays] Length = 356 Score = 184 bits (468), Expect = 2e-44 Identities = 86/92 (93%), Positives = 88/92 (95%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEK IAEYIWIGGSGMD+RSKARTLPG V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKFIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >ref|XP_010932552.1| PREDICTED: glutamine synthetase nodule isozyme [Elaeis guineensis] Length = 356 Score = 184 bits (466), Expect = 3e-44 Identities = 87/92 (94%), Positives = 88/92 (95%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMDIRSKARTLPG V+ SKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDIRSKARTLPGPVTDSSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >ref|XP_010916212.1| PREDICTED: glutamine synthetase nodule isozyme-like [Elaeis guineensis] Length = 357 Score = 184 bits (466), Expect = 3e-44 Identities = 86/92 (93%), Positives = 88/92 (95%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEK+IAEYIWIGGSGMDIRSKARTLPG VS PSKLPKWNYDGSSTGQAPG+DSEVIL PQ Sbjct: 16 TEKVIAEYIWIGGSGMDIRSKARTLPGPVSDPSKLPKWNYDGSSTGQAPGKDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTN R Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNTR 107 >gb|AFB69879.1| glutamine synthetase isoform 1-1 [Secale cereale] Length = 356 Score = 184 bits (466), Expect = 3e-44 Identities = 85/92 (92%), Positives = 89/92 (96%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 T+KIIAEYIWIGGSGMD+RSKARTLPG V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TDKIIAEYIWIGGSGMDLRSKARTLPGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFR+GNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRKGNNILVMCDCYTPAGEPIPTNKR 107 >ref|XP_009393673.1| PREDICTED: glutamine synthetase nodule isozyme [Musa acuminata subsp. malaccensis] Length = 356 Score = 183 bits (465), Expect = 3e-44 Identities = 86/92 (93%), Positives = 88/92 (95%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSG+DIRSKARTLPG VS PSKLP WNYDGSSTGQAPG+DSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGLDIRSKARTLPGPVSDPSKLPTWNYDGSSTGQAPGDDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >ref|NP_001105296.1| glutamine synthetase root isozyme 3 [Zea mays] gi|286124|dbj|BAA03431.1| glutamine synthetase [Zea mays] gi|194708400|gb|ACF88284.1| unknown [Zea mays] gi|308195941|gb|ADO17336.1| glutamine synthetase [Zea mays] gi|308195943|gb|ADO17337.1| glutamine synthetase [Zea mays] gi|308195945|gb|ADO17338.1| glutamine synthetase [Zea mays] gi|308195947|gb|ADO17339.1| glutamine synthetase [Zea mays] gi|413938748|gb|AFW73299.1| glutamine synthetase4 [Zea mays] Length = 356 Score = 183 bits (464), Expect = 4e-44 Identities = 86/92 (93%), Positives = 88/92 (95%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTL G V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >gb|ACA50923.1| glutamine synthetase [Zea mays] Length = 356 Score = 183 bits (464), Expect = 4e-44 Identities = 86/92 (93%), Positives = 88/92 (95%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTL G V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >sp|P38561.1|GLNA3_MAIZE RecName: Full=Glutamine synthetase root isozyme 3; AltName: Full=GS112; AltName: Full=Glutamate--ammonia ligase gi|434328|emb|CAA46721.1| glutamine synthetase [Zea mays] Length = 356 Score = 183 bits (464), Expect = 4e-44 Identities = 86/92 (93%), Positives = 88/92 (95%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTL G V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >ref|XP_010236151.1| PREDICTED: glutamine synthetase cytosolic isozyme 1-1 [Brachypodium distachyon] Length = 356 Score = 183 bits (464), Expect = 4e-44 Identities = 86/92 (93%), Positives = 88/92 (95%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTL G V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107 >gb|AAW21273.1| glutamine synthetase [Saccharum officinarum] Length = 356 Score = 183 bits (464), Expect = 4e-44 Identities = 86/92 (93%), Positives = 88/92 (95%) Frame = -1 Query: 278 TEKIIAEYIWIGGSGMDIRSKARTLPGSVSGPSKLPKWNYDGSSTGQAPGEDSEVILNPQ 99 TEKIIAEYIWIGGSGMD+RSKARTL G V+ PSKLPKWNYDGSSTGQAPGEDSEVIL PQ Sbjct: 16 TEKIIAEYIWIGGSGMDLRSKARTLSGPVTDPSKLPKWNYDGSSTGQAPGEDSEVILYPQ 75 Query: 98 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 3 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR Sbjct: 76 AIFKDPFRRGNNILVMCDCYTPAGEPIPTNKR 107