BLASTX nr result
ID: Anemarrhena21_contig00001409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00001409 (357 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKD00050.1| hypothetical protein A1Q2_05642 [Trichosporon asa... 58 3e-06 >gb|EKD00050.1| hypothetical protein A1Q2_05642 [Trichosporon asahii var. asahii CBS 8904] Length = 165 Score = 57.8 bits (138), Expect = 3e-06 Identities = 36/79 (45%), Positives = 42/79 (53%), Gaps = 11/79 (13%) Frame = -2 Query: 347 EAR-WGRGPPTWKRDEVEERAFGKSPPGWKRDEVEERAFGKSPPGWKRDEVE-------- 195 EAR W + PP WKRD E R + + PP WKRD EER + + PP WKRD E Sbjct: 86 EARDWTQVPPHWKRDN-EARDWTQVPPHWKRDN-EERDWTQVPPHWKRDNEERDWTQVPP 143 Query: 194 --KRDEIEARWGRGPPTLK 144 KRD E W + PP K Sbjct: 144 QWKRDNEERDWTQVPPQWK 162