BLASTX nr result
ID: Anemarrhena21_contig00000966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00000966 (848 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009421015.1| PREDICTED: nudix hydrolase 13, mitochondrial... 60 2e-06 ref|XP_010250478.1| PREDICTED: nudix hydrolase 12, mitochondrial... 58 7e-06 >ref|XP_009421015.1| PREDICTED: nudix hydrolase 13, mitochondrial isoform X1 [Musa acuminata subsp. malaccensis] Length = 224 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = -1 Query: 152 CLRLGVFAFSIMSLAVLARVGRHRQRYENELRLVAGCIPYRLK 24 CLR F MS +LAR GRH+QRY+N+LRLVAGCIPY++K Sbjct: 15 CLRSSFFCRGSMSSPLLARKGRHQQRYDNQLRLVAGCIPYKVK 57 >ref|XP_010250478.1| PREDICTED: nudix hydrolase 12, mitochondrial-like [Nelumbo nucifera] Length = 256 Score = 58.2 bits (139), Expect = 7e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 113 LAVLARVGRHRQRYENELRLVAGCIPYRLKPVVPD 9 L +LAR GRHRQRYE++LRLVAGCIPYRLK V D Sbjct: 2 LPLLARTGRHRQRYEDQLRLVAGCIPYRLKEDVDD 36