BLASTX nr result
ID: Anemarrhena21_contig00000594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00000594 (1022 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279333.3| PREDICTED: hydrophobic protein LTI6A [Vitis ... 78 1e-11 ref|XP_010094907.1| Hydrophobic protein LTI6A [Morus notabilis] ... 77 2e-11 ref|XP_012464989.1| PREDICTED: hydrophobic protein RCI2B [Gossyp... 76 3e-11 gb|KHG20782.1| Hydrophobic RCI2B -like protein [Gossypium arboreum] 76 3e-11 ref|XP_008246327.1| PREDICTED: hydrophobic protein RCI2B [Prunus... 76 3e-11 ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prun... 76 3e-11 gb|AAQ84111.1| Clt1 [Citrus trifoliata] 76 4e-11 gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6... 75 6e-11 ref|XP_010694119.1| PREDICTED: hydrophobic protein LTI6A [Beta v... 75 7e-11 gb|KGN65991.1| hypothetical protein Csa_1G560745 [Cucumis sativus] 75 7e-11 ref|XP_008450512.1| PREDICTED: hydrophobic protein LTI6B-like [C... 75 7e-11 ref|XP_011621874.1| PREDICTED: hydrophobic protein RCI2B [Ambore... 75 1e-10 ref|XP_009366018.1| PREDICTED: hydrophobic protein RCI2A-like [P... 75 1e-10 ref|XP_008370335.1| PREDICTED: hydrophobic protein RCI2A [Malus ... 75 1e-10 ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, part... 75 1e-10 gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] 75 1e-10 gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Gr... 75 1e-10 ref|XP_012854064.1| PREDICTED: hydrophobic protein RCI2B-like [E... 74 1e-10 ref|XP_009366021.1| PREDICTED: hydrophobic protein RCI2B [Pyrus ... 74 1e-10 gb|ADE77881.1| unknown [Picea sitchensis] 74 1e-10 >ref|XP_002279333.3| PREDICTED: hydrophobic protein LTI6A [Vitis vinifera] gi|731416065|ref|XP_010659763.1| PREDICTED: hydrophobic protein LTI6A [Vitis vinifera] Length = 53 Score = 77.8 bits (190), Expect = 1e-11 Identities = 36/51 (70%), Positives = 38/51 (74%) Frame = -2 Query: 949 ANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 A C LGVFLKFGCQAEFWICLVLT FGYLPGI+YAVY+ITK Sbjct: 3 ATCIDILLAIILPPLGVFLKFGCQAEFWICLVLTFFGYLPGIVYAVYVITK 53 >ref|XP_010094907.1| Hydrophobic protein LTI6A [Morus notabilis] gi|587868183|gb|EXB57550.1| Hydrophobic protein LTI6A [Morus notabilis] Length = 57 Score = 77.0 bits (188), Expect = 2e-11 Identities = 36/52 (69%), Positives = 40/52 (76%) Frame = -2 Query: 952 NANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 +A C LGVFLKFGC+AEFWICL+LT+FGYLPGIIYAVYIITK Sbjct: 6 SATCVDILLAIILPPLGVFLKFGCRAEFWICLLLTLFGYLPGIIYAVYIITK 57 >ref|XP_012464989.1| PREDICTED: hydrophobic protein RCI2B [Gossypium raimondii] gi|763815865|gb|KJB82717.1| hypothetical protein B456_013G210800 [Gossypium raimondii] gi|763815866|gb|KJB82718.1| hypothetical protein B456_013G210800 [Gossypium raimondii] Length = 57 Score = 76.3 bits (186), Expect = 3e-11 Identities = 35/53 (66%), Positives = 38/53 (71%) Frame = -2 Query: 955 SNANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 S A C LGVFLKFGCQ EFWICLVLT+FGY+PGIIYA+Y ITK Sbjct: 5 STATCVDILLAIILPPLGVFLKFGCQVEFWICLVLTLFGYIPGIIYAIYAITK 57 >gb|KHG20782.1| Hydrophobic RCI2B -like protein [Gossypium arboreum] Length = 57 Score = 76.3 bits (186), Expect = 3e-11 Identities = 35/53 (66%), Positives = 38/53 (71%) Frame = -2 Query: 955 SNANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 S A C LGVFLKFGCQ EFWICLVLT+FGY+PGIIYA+Y ITK Sbjct: 5 STATCIDILLAIILPPLGVFLKFGCQVEFWICLVLTLFGYIPGIIYAIYAITK 57 >ref|XP_008246327.1| PREDICTED: hydrophobic protein RCI2B [Prunus mume] Length = 54 Score = 76.3 bits (186), Expect = 3e-11 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -2 Query: 904 GVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 GVFLKFGC+AEFWICL+LT+FGYLPGIIYA+YI+TK Sbjct: 19 GVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 54 >ref|XP_007206183.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica] gi|462401825|gb|EMJ07382.1| hypothetical protein PRUPE_ppa013857mg [Prunus persica] Length = 93 Score = 76.3 bits (186), Expect = 3e-11 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = -2 Query: 904 GVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 GVFLKFGC+AEFWICL+LT+FGYLPGIIYA+YI+TK Sbjct: 58 GVFLKFGCEAEFWICLILTLFGYLPGIIYAIYILTK 93 >gb|AAQ84111.1| Clt1 [Citrus trifoliata] Length = 54 Score = 75.9 bits (185), Expect = 4e-11 Identities = 35/54 (64%), Positives = 39/54 (72%) Frame = -2 Query: 958 MSNANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 M A C LGVFLKFGC+AEFWICL+LTI GY+PGIIYAVY+ITK Sbjct: 1 MGTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYVITK 54 >gb|AFC41201.1| PM-YC3.6-Lti6b [Binary expression vector PM-YC3.6-LTI6b] Length = 726 Score = 75.5 bits (184), Expect = 6e-11 Identities = 35/63 (55%), Positives = 44/63 (69%) Frame = -2 Query: 985 IFSSQLKSTMSNANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYI 806 I++ + + MS A LGVFLKFGC+ EFWICL+LT+FGYLPGI+YA+YI Sbjct: 664 IYACRQAAAMSTATFVEIILAIILPPLGVFLKFGCKVEFWICLILTLFGYLPGILYALYI 723 Query: 805 ITK 797 ITK Sbjct: 724 ITK 726 >ref|XP_010694119.1| PREDICTED: hydrophobic protein LTI6A [Beta vulgaris subsp. vulgaris] gi|870845968|gb|KMS98602.1| hypothetical protein BVRB_3g070450 [Beta vulgaris subsp. vulgaris] Length = 56 Score = 75.1 bits (183), Expect = 7e-11 Identities = 36/53 (67%), Positives = 37/53 (69%) Frame = -2 Query: 955 SNANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 S A C LGVFLKFGC+ EFWICLVLT FGYLPGIIYAVY ITK Sbjct: 4 STATCIDILLAIILPPLGVFLKFGCKVEFWICLVLTFFGYLPGIIYAVYAITK 56 >gb|KGN65991.1| hypothetical protein Csa_1G560745 [Cucumis sativus] Length = 57 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/50 (70%), Positives = 36/50 (72%) Frame = -2 Query: 946 NCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 NC LGVFLKFGCQ EFWICLVLT FGY+PGIIYAVY ITK Sbjct: 8 NCIDILLAILLPPLGVFLKFGCQVEFWICLVLTFFGYIPGIIYAVYAITK 57 >ref|XP_008450512.1| PREDICTED: hydrophobic protein LTI6B-like [Cucumis melo] Length = 57 Score = 75.1 bits (183), Expect = 7e-11 Identities = 35/50 (70%), Positives = 36/50 (72%) Frame = -2 Query: 946 NCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 NC LGVFLKFGCQ EFWICLVLT FGY+PGIIYAVY ITK Sbjct: 8 NCIDILLAILLPPLGVFLKFGCQVEFWICLVLTFFGYIPGIIYAVYAITK 57 >ref|XP_011621874.1| PREDICTED: hydrophobic protein RCI2B [Amborella trichopoda] Length = 56 Score = 74.7 bits (182), Expect = 1e-10 Identities = 35/53 (66%), Positives = 38/53 (71%) Frame = -2 Query: 955 SNANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 S A C LGVFLKFGC+ EFWICLVLT+FGY+PGIIYAVY ITK Sbjct: 4 STATCVDIILAIILPPLGVFLKFGCKVEFWICLVLTLFGYVPGIIYAVYAITK 56 >ref|XP_009366018.1| PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] gi|694379683|ref|XP_009366019.1| PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] Length = 54 Score = 74.7 bits (182), Expect = 1e-10 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = -2 Query: 958 MSNANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 M A C LGVFL+FGC +EFWICLVLT+FGYLPGIIYA+Y ITK Sbjct: 1 MGTATCVDIIIAILLPPLGVFLRFGCHSEFWICLVLTLFGYLPGIIYAIYAITK 54 >ref|XP_008370335.1| PREDICTED: hydrophobic protein RCI2A [Malus domestica] gi|658020398|ref|XP_008345581.1| PREDICTED: hydrophobic protein RCI2A [Malus domestica] Length = 54 Score = 74.7 bits (182), Expect = 1e-10 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = -2 Query: 958 MSNANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 M A C LGVFL+FGC +EFWICLVLT+FGYLPGIIYA+Y ITK Sbjct: 1 MGTATCIDIIIAILLPPLGVFLRFGCHSEFWICLVLTLFGYLPGIIYAIYAITK 54 >ref|XP_006428345.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] gi|557530402|gb|ESR41585.1| hypothetical protein CICLE_v10013710mg, partial [Citrus clementina] Length = 104 Score = 74.7 bits (182), Expect = 1e-10 Identities = 38/64 (59%), Positives = 44/64 (68%), Gaps = 1/64 (1%) Frame = -2 Query: 985 IFSSQLK-STMSNANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVY 809 +F +Q K + S A C LGVFLKFGC+AEFWICL+LTI GY+PGIIYAVY Sbjct: 40 LFKNQSKMADGSTATCVDILLAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVY 99 Query: 808 IITK 797 ITK Sbjct: 100 AITK 103 >gb|ADK27677.1| plasma membrane protein 3-2 [Salvia miltiorrhiza] Length = 54 Score = 74.7 bits (182), Expect = 1e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = -2 Query: 904 GVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 GVFLKFGC AEFWICL+LT+FGY+PGIIYA+YIITK Sbjct: 19 GVFLKFGCGAEFWICLILTLFGYIPGIIYAIYIITK 54 >gb|ACA66247.1| cold-induced plasma membrane protein [Musa ABB Group] Length = 57 Score = 74.7 bits (182), Expect = 1e-10 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = -2 Query: 949 ANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 ANC LGVFLKFGC+ EFWICL+LT+FGY+PGIIYAVY ITK Sbjct: 7 ANCIDILLAIILPPLGVFLKFGCEMEFWICLLLTLFGYIPGIIYAVYAITK 57 >ref|XP_012854064.1| PREDICTED: hydrophobic protein RCI2B-like [Erythranthe guttatus] Length = 55 Score = 74.3 bits (181), Expect = 1e-10 Identities = 35/54 (64%), Positives = 38/54 (70%) Frame = -2 Query: 958 MSNANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 M A C LGVFLKFGC+ EFWICL+LTIFGYLPGIIYA+Y ITK Sbjct: 1 MGAATCIDIILAIILPPLGVFLKFGCKLEFWICLLLTIFGYLPGIIYAIYAITK 54 >ref|XP_009366021.1| PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] gi|694379688|ref|XP_009366022.1| PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] Length = 54 Score = 74.3 bits (181), Expect = 1e-10 Identities = 33/54 (61%), Positives = 39/54 (72%) Frame = -2 Query: 958 MSNANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 M A C LGVFL+FGC +EFWICLVLT+FGY+PGI+YA+YIITK Sbjct: 1 MGTATCIDIILAILLPPLGVFLRFGCHSEFWICLVLTLFGYIPGILYALYIITK 54 >gb|ADE77881.1| unknown [Picea sitchensis] Length = 53 Score = 74.3 bits (181), Expect = 1e-10 Identities = 35/51 (68%), Positives = 37/51 (72%) Frame = -2 Query: 949 ANCXXXXXXXXXXXLGVFLKFGCQAEFWICLVLTIFGYLPGIIYAVYIITK 797 ANC LGVFLKFGC AEFWICL+LTI GY+PGIIYAVY ITK Sbjct: 3 ANCLDILLAIILPPLGVFLKFGCNAEFWICLLLTILGYIPGIIYAVYAITK 53