BLASTX nr result
ID: Alisma22_contig00044738
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00044738 (214 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT65361.1 putative transcription factor PosF21, partial [Anthur... 84 9e-19 XP_011037123.1 PREDICTED: probable transcription factor PosF21 i... 87 1e-18 XP_011037122.1 PREDICTED: probable transcription factor PosF21 i... 87 2e-18 XP_006372845.1 hypothetical protein POPTR_0017s05610g [Populus t... 87 2e-18 GAV64315.1 bZIP_1 domain-containing protein [Cephalotus follicul... 87 2e-18 XP_015867590.1 PREDICTED: probable transcription factor PosF21 [... 87 2e-18 XP_006597221.1 PREDICTED: probable transcription factor PosF21 [... 86 3e-18 KHN33298.1 Putative transcription factor PosF21 [Glycine soja] 86 3e-18 XP_009760637.1 PREDICTED: probable transcription factor PosF21, ... 82 5e-18 XP_010086697.1 putative transcription factor PosF21 [Morus notab... 86 6e-18 KYP58430.1 putative transcription factor PosF21 [Cajanus cajan] 84 6e-18 XP_009383435.1 PREDICTED: probable transcription factor PosF21 i... 85 7e-18 XP_009383434.1 PREDICTED: probable transcription factor PosF21 i... 85 7e-18 XP_012065205.1 PREDICTED: probable transcription factor PosF21 [... 85 1e-17 XP_004309615.1 PREDICTED: probable transcription factor PosF21 [... 85 1e-17 XP_018630170.1 PREDICTED: probable transcription factor PosF21 [... 82 1e-17 XP_010672248.1 PREDICTED: probable transcription factor PosF21 [... 84 1e-17 XP_009402686.1 PREDICTED: transcription factor RF2a-like [Musa a... 84 1e-17 OAY51868.1 hypothetical protein MANES_04G039500 [Manihot esculenta] 84 1e-17 XP_002529479.1 PREDICTED: probable transcription factor PosF21 [... 84 1e-17 >JAT65361.1 putative transcription factor PosF21, partial [Anthurium amnicola] Length = 177 Score = 84.0 bits (206), Expect = 9e-19 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 RFSHD+S MPDFPPR+ GHRRAHSEIL+LPDDITFDS+LGVVG G Sbjct: 60 RFSHDISTMPDFPPRNPGHRRAHSEILSLPDDITFDSELGVVGAVDG 106 >XP_011037123.1 PREDICTED: probable transcription factor PosF21 isoform X2 [Populus euphratica] Length = 406 Score = 87.0 bits (214), Expect = 1e-18 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGA 209 RFSHD+SRMPD PP++ GHRRAHSEIL LPDDI+FDSDLGVVGGGA Sbjct: 64 RFSHDISRMPDNPPKNLGHRRAHSEILTLPDDISFDSDLGVVGGGA 109 >XP_011037122.1 PREDICTED: probable transcription factor PosF21 isoform X1 [Populus euphratica] Length = 420 Score = 87.0 bits (214), Expect = 2e-18 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGA 209 RFSHD+SRMPD PP++ GHRRAHSEIL LPDDI+FDSDLGVVGGGA Sbjct: 64 RFSHDISRMPDNPPKNLGHRRAHSEILTLPDDISFDSDLGVVGGGA 109 >XP_006372845.1 hypothetical protein POPTR_0017s05610g [Populus trichocarpa] ERP50642.1 hypothetical protein POPTR_0017s05610g [Populus trichocarpa] Length = 424 Score = 87.0 bits (214), Expect = 2e-18 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGA 209 RFSHD+SRMPD PP++ GHRRAHSEIL LPDDI+FDSDLGVVGGGA Sbjct: 64 RFSHDISRMPDNPPKNLGHRRAHSEILTLPDDISFDSDLGVVGGGA 109 >GAV64315.1 bZIP_1 domain-containing protein [Cephalotus follicularis] Length = 425 Score = 87.0 bits (214), Expect = 2e-18 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 RFSHD+SRMPD PP++ GHRRAHSEIL LPDDI+FDSDLGVVGGG G Sbjct: 63 RFSHDISRMPDNPPKNRGHRRAHSEILTLPDDISFDSDLGVVGGGDG 109 >XP_015867590.1 PREDICTED: probable transcription factor PosF21 [Ziziphus jujuba] XP_015867591.1 PREDICTED: probable transcription factor PosF21 [Ziziphus jujuba] XP_015867592.1 PREDICTED: probable transcription factor PosF21 [Ziziphus jujuba] Length = 427 Score = 86.7 bits (213), Expect = 2e-18 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 RFSHDLSRMPD PPR+ GHRRAHSEIL LPDDI+FDSDLGVVGG G Sbjct: 66 RFSHDLSRMPDNPPRNLGHRRAHSEILTLPDDISFDSDLGVVGGADG 112 >XP_006597221.1 PREDICTED: probable transcription factor PosF21 [Glycine max] KRH10117.1 hypothetical protein GLYMA_15G029100 [Glycine max] KRH10118.1 hypothetical protein GLYMA_15G029100 [Glycine max] Length = 420 Score = 86.3 bits (212), Expect = 3e-18 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +3 Query: 75 FSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 FSHD+SRMPD PPR+ GHRRAHSEIL LPDDI+FDSDLGVVGGG G Sbjct: 67 FSHDISRMPDNPPRNRGHRRAHSEILTLPDDISFDSDLGVVGGGDG 112 >KHN33298.1 Putative transcription factor PosF21 [Glycine soja] Length = 425 Score = 86.3 bits (212), Expect = 3e-18 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +3 Query: 75 FSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 FSHD+SRMPD PPR+ GHRRAHSEIL LPDDI+FDSDLGVVGGG G Sbjct: 67 FSHDISRMPDNPPRNRGHRRAHSEILTLPDDISFDSDLGVVGGGDG 112 >XP_009760637.1 PREDICTED: probable transcription factor PosF21, partial [Nicotiana sylvestris] Length = 163 Score = 81.6 bits (200), Expect = 5e-18 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGG 203 +FSHD+SRMPD PP++ GHRRAHSEIL LPDDI+FDSDLGVVGG Sbjct: 54 QFSHDISRMPDNPPKNLGHRRAHSEILTLPDDISFDSDLGVVGG 97 >XP_010086697.1 putative transcription factor PosF21 [Morus notabilis] EXB23113.1 putative transcription factor PosF21 [Morus notabilis] Length = 429 Score = 85.5 bits (210), Expect = 6e-18 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 RFSHD+SRMPD PPR GHRRAHSEIL LPDDI+FDSDLGVVGG G Sbjct: 65 RFSHDISRMPDNPPRKLGHRRAHSEILTLPDDISFDSDLGVVGGADG 111 >KYP58430.1 putative transcription factor PosF21 [Cajanus cajan] Length = 279 Score = 84.0 bits (206), Expect = 6e-18 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +3 Query: 75 FSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 FSHD+SRMPD PPR+ GHRRAHSEIL LPDDI+FDSDLGVVGG G Sbjct: 72 FSHDISRMPDNPPRNRGHRRAHSEILTLPDDISFDSDLGVVGGADG 117 >XP_009383435.1 PREDICTED: probable transcription factor PosF21 isoform X2 [Musa acuminata subsp. malaccensis] Length = 396 Score = 85.1 bits (209), Expect = 7e-18 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 RFSHD+ RMPD PPR+AGHRRAHSEIL+LPDDI+FDS+LG+VG G G Sbjct: 55 RFSHDIDRMPDNPPRNAGHRRAHSEILSLPDDISFDSELGIVGSGEG 101 >XP_009383434.1 PREDICTED: probable transcription factor PosF21 isoform X1 [Musa acuminata subsp. malaccensis] Length = 411 Score = 85.1 bits (209), Expect = 7e-18 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 RFSHD+ RMPD PPR+AGHRRAHSEIL+LPDDI+FDS+LG+VG G G Sbjct: 55 RFSHDIDRMPDNPPRNAGHRRAHSEILSLPDDISFDSELGIVGSGEG 101 >XP_012065205.1 PREDICTED: probable transcription factor PosF21 [Jatropha curcas] KDP43884.1 hypothetical protein JCGZ_20894 [Jatropha curcas] Length = 418 Score = 84.7 bits (208), Expect = 1e-17 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 RFSHD+SRMPD PP++ GHRRAHSEIL LPDDI+FDSDLGVVGG G Sbjct: 63 RFSHDISRMPDNPPKNLGHRRAHSEILTLPDDISFDSDLGVVGGADG 109 >XP_004309615.1 PREDICTED: probable transcription factor PosF21 [Fragaria vesca subsp. vesca] Length = 445 Score = 84.7 bits (208), Expect = 1e-17 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +3 Query: 75 FSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 FSHD+SRMPD+PPR GHRRAHSEI+ LPDDI+FDSDLGVVGG G Sbjct: 67 FSHDISRMPDYPPRKLGHRRAHSEIVTLPDDISFDSDLGVVGGADG 112 >XP_018630170.1 PREDICTED: probable transcription factor PosF21 [Nicotiana tomentosiformis] Length = 236 Score = 82.4 bits (202), Expect = 1e-17 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGG 203 RFSHD+SRMPD PP+ GHRRAHSEIL LPDDI+FDSDLGVVGG Sbjct: 66 RFSHDISRMPDNPPKKFGHRRAHSEILTLPDDISFDSDLGVVGG 109 >XP_010672248.1 PREDICTED: probable transcription factor PosF21 [Beta vulgaris subsp. vulgaris] KMT15795.1 hypothetical protein BVRB_3g057700 [Beta vulgaris subsp. vulgaris] Length = 388 Score = 84.3 bits (207), Expect = 1e-17 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +3 Query: 75 FSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGG 206 FSHDLSRMPD PP++ GHRRAHSEIL LPDDI+FDSDLGVVGGG Sbjct: 42 FSHDLSRMPDNPPKNMGHRRAHSEILTLPDDISFDSDLGVVGGG 85 >XP_009402686.1 PREDICTED: transcription factor RF2a-like [Musa acuminata subsp. malaccensis] XP_009402687.1 PREDICTED: transcription factor RF2a-like [Musa acuminata subsp. malaccensis] XP_018681530.1 PREDICTED: transcription factor RF2a-like [Musa acuminata subsp. malaccensis] Length = 411 Score = 84.3 bits (207), Expect = 1e-17 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +3 Query: 75 FSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 FSHD+SRMPDFPPR+ GHRRAHSEIL+LPDDI+FDSDLGVVG G Sbjct: 58 FSHDVSRMPDFPPRNPGHRRAHSEILSLPDDISFDSDLGVVGSHDG 103 >OAY51868.1 hypothetical protein MANES_04G039500 [Manihot esculenta] Length = 412 Score = 84.3 bits (207), Expect = 1e-17 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 RFSHD+SRMPD PP+ GHRRAHSEIL LPDDI+FDSDLGVVGG G Sbjct: 63 RFSHDISRMPDNPPKKLGHRRAHSEILTLPDDISFDSDLGVVGGADG 109 >XP_002529479.1 PREDICTED: probable transcription factor PosF21 [Ricinus communis] EEF32889.1 Transcription factor RF2a, putative [Ricinus communis] Length = 425 Score = 84.3 bits (207), Expect = 1e-17 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = +3 Query: 72 RFSHDLSRMPDFPPRSAGHRRAHSEILALPDDITFDSDLGVVGGGAG 212 RFSHD+SRMPD PP+ GHRRAHSEIL LPDDI+FDSDLGVVGG G Sbjct: 62 RFSHDISRMPDNPPKKLGHRRAHSEILTLPDDISFDSDLGVVGGADG 108