BLASTX nr result
ID: Alisma22_contig00044651
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00044651 (311 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_020103583.1 B3 domain-containing protein Os06g0194400-like [A... 68 1e-11 JAT49681.1 B3 domain-containing protein Os06g0194400 [Anthurium ... 68 2e-11 CDP07203.1 unnamed protein product [Coffea canephora] 67 3e-11 XP_017697986.1 PREDICTED: B3 domain-containing protein Os06g0194... 67 4e-11 XP_008788064.1 PREDICTED: B3 domain-containing protein Os06g0194... 67 4e-11 XP_010922413.1 PREDICTED: B3 domain-containing protein Os06g0194... 66 7e-11 XP_010922411.1 PREDICTED: B3 domain-containing protein Os06g0194... 66 7e-11 XP_020104966.1 B3 domain-containing protein Os03g0184500-like [A... 65 1e-10 XP_006384420.1 hypothetical protein POPTR_0004s14910g [Populus t... 65 1e-10 XP_019257395.1 PREDICTED: B3 domain-containing protein At3g19184... 65 1e-10 XP_009772546.1 PREDICTED: B3 domain-containing protein At3g19184... 65 1e-10 XP_006842572.1 PREDICTED: B3 domain-containing protein Os05g0481... 65 2e-10 OAY36102.1 hypothetical protein MANES_12G155800 [Manihot esculenta] 66 2e-10 XP_010691035.1 PREDICTED: B3 domain-containing protein At3g19184... 65 2e-10 XP_019157841.1 PREDICTED: B3 domain-containing protein At3g19184... 65 2e-10 XP_011000309.1 PREDICTED: B3 domain-containing protein At3g19184... 65 2e-10 XP_010519303.1 PREDICTED: B3 domain-containing protein At3g19184... 65 2e-10 XP_006379203.1 hypothetical protein POPTR_0009s10600g [Populus t... 65 2e-10 XP_002313112.2 hypothetical protein POPTR_0009s10590g [Populus t... 65 2e-10 XP_006379204.1 hypothetical protein POPTR_0009s10600g [Populus t... 65 2e-10 >XP_020103583.1 B3 domain-containing protein Os06g0194400-like [Ananas comosus] Length = 227 Score = 68.2 bits (165), Expect = 1e-11 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRASG 122 GLSGGWRGFSL H LV+GD LVFQL++P +FKV+I RASG Sbjct: 184 GLSGGWRGFSLHHELVDGDALVFQLIEPARFKVHIIRASG 223 >JAT49681.1 B3 domain-containing protein Os06g0194400 [Anthurium amnicola] Length = 236 Score = 67.8 bits (164), Expect = 2e-11 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRASGTSHATKEFTYPKIKKQ 170 GLS GWRGFS++H LV+GD LVF+LV P KFKVYI R SG A + KI K+ Sbjct: 181 GLSAGWRGFSIDHGLVDGDALVFELVTPTKFKVYIIRQSGYYEADEANGSKKISKR 236 >CDP07203.1 unnamed protein product [Coffea canephora] Length = 274 Score = 67.4 bits (163), Expect = 3e-11 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRAS 119 GLSGGWRGFS+EH LV+GD LVFQL++P KFKVYI R + Sbjct: 229 GLSGGWRGFSIEHELVDGDALVFQLIEPTKFKVYIIRVN 267 >XP_017697986.1 PREDICTED: B3 domain-containing protein Os06g0194400 isoform X2 [Phoenix dactylifera] Length = 225 Score = 66.6 bits (161), Expect = 4e-11 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRASG 122 GLSGGWRGFS+ H LV+GD LVFQLV P FKVYI RASG Sbjct: 182 GLSGGWRGFSIYHELVDGDALVFQLVKPTTFKVYIIRASG 221 >XP_008788064.1 PREDICTED: B3 domain-containing protein Os06g0194400 isoform X1 [Phoenix dactylifera] XP_008788065.1 PREDICTED: B3 domain-containing protein Os06g0194400 isoform X1 [Phoenix dactylifera] XP_017697966.1 PREDICTED: B3 domain-containing protein Os06g0194400-like [Phoenix dactylifera] Length = 226 Score = 66.6 bits (161), Expect = 4e-11 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRASG 122 GLSGGWRGFS+ H LV+GD LVFQLV P FKVYI RASG Sbjct: 183 GLSGGWRGFSIYHELVDGDALVFQLVKPTTFKVYIIRASG 222 >XP_010922413.1 PREDICTED: B3 domain-containing protein Os06g0194400 isoform X2 [Elaeis guineensis] Length = 225 Score = 65.9 bits (159), Expect = 7e-11 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRASG 122 GLSGGWRGFS+ H LV+GD L+FQL+ P FKVYI RASG Sbjct: 182 GLSGGWRGFSIYHELVDGDALIFQLIKPTTFKVYIIRASG 221 >XP_010922411.1 PREDICTED: B3 domain-containing protein Os06g0194400 isoform X1 [Elaeis guineensis] XP_010922412.1 PREDICTED: B3 domain-containing protein Os06g0194400 isoform X1 [Elaeis guineensis] Length = 226 Score = 65.9 bits (159), Expect = 7e-11 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRASG 122 GLSGGWRGFS+ H LV+GD L+FQL+ P FKVYI RASG Sbjct: 183 GLSGGWRGFSIYHELVDGDALIFQLIKPTTFKVYIIRASG 222 >XP_020104966.1 B3 domain-containing protein Os03g0184500-like [Ananas comosus] OAY66698.1 B3 domain-containing protein [Ananas comosus] Length = 240 Score = 65.5 bits (158), Expect = 1e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRASG 122 GLSGGW+GFS+ H L++GD LVFQL++P KFKVYI RA G Sbjct: 187 GLSGGWQGFSVFHELIDGDALVFQLIEPTKFKVYIIRAGG 226 >XP_006384420.1 hypothetical protein POPTR_0004s14910g [Populus trichocarpa] ERP62217.1 hypothetical protein POPTR_0004s14910g [Populus trichocarpa] Length = 193 Score = 64.7 bits (156), Expect = 1e-10 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRASGTS 128 GLSGGWRGFS+EH L+E DTLVFQL++P K K+YI RA+ S Sbjct: 71 GLSGGWRGFSIEHRLLEQDTLVFQLIEPDKLKIYIVRANRLS 112 >XP_019257395.1 PREDICTED: B3 domain-containing protein At3g19184-like [Nicotiana attenuata] OIS96356.1 b3 domain-containing protein [Nicotiana attenuata] Length = 225 Score = 65.1 bits (157), Expect = 1e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRAS 119 GLSGGWRGF+++H LV+GD LVFQL++P KFKVYI R + Sbjct: 183 GLSGGWRGFAIDHELVDGDALVFQLIEPTKFKVYIIRVN 221 >XP_009772546.1 PREDICTED: B3 domain-containing protein At3g19184-like [Nicotiana sylvestris] XP_016513011.1 PREDICTED: B3 domain-containing protein At3g19184-like [Nicotiana tabacum] Length = 225 Score = 65.1 bits (157), Expect = 1e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRAS 119 GLSGGWRGF+++H LV+GD LVFQL++P KFKVYI R + Sbjct: 183 GLSGGWRGFAIDHELVDGDALVFQLIEPTKFKVYIIRVN 221 >XP_006842572.1 PREDICTED: B3 domain-containing protein Os05g0481400 [Amborella trichopoda] ERN04247.1 hypothetical protein AMTR_s00077p00151100 [Amborella trichopoda] Length = 287 Score = 65.5 bits (158), Expect = 2e-10 Identities = 29/64 (45%), Positives = 44/64 (68%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRASGTSHATKEFTYPKIKKQFVKK 182 GLSGGW+GF+++H L +GD LVF+L++P KFKVYI + S ++ KE KK + Sbjct: 182 GLSGGWKGFAVDHKLDDGDALVFELIEPTKFKVYIIKVSEYNNEEKEKPTGSTKKTKCES 241 Query: 183 QRRY 194 +++Y Sbjct: 242 RKKY 245 >OAY36102.1 hypothetical protein MANES_12G155800 [Manihot esculenta] Length = 359 Score = 65.9 bits (159), Expect = 2e-10 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRASG 122 GLSGGWRGFS+ H L+EGD LVFQLV P KFKVYI R +G Sbjct: 54 GLSGGWRGFSIAHELLEGDVLVFQLVRPTKFKVYIVRVNG 93 >XP_010691035.1 PREDICTED: B3 domain-containing protein At3g19184 [Beta vulgaris subsp. vulgaris] KMT00576.1 hypothetical protein BVRB_9g218740 [Beta vulgaris subsp. vulgaris] Length = 251 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/54 (53%), Positives = 38/54 (70%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRASGTSHATKEFTYPKIK 164 GLSGGWRGFS++H LV+GD LVFQL++P FKVYI R + +E + +K Sbjct: 185 GLSGGWRGFSIDHELVDGDALVFQLIEPSIFKVYIIRVNSLEEDEEESSDENVK 238 >XP_019157841.1 PREDICTED: B3 domain-containing protein At3g19184 [Ipomoea nil] Length = 227 Score = 64.7 bits (156), Expect = 2e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRAS 119 GLSGGWRGF+L+H LV+GD LVFQL++P +FKVYI R + Sbjct: 181 GLSGGWRGFALDHELVDGDALVFQLIEPTRFKVYIIRVN 219 >XP_011000309.1 PREDICTED: B3 domain-containing protein At3g19184-like [Populus euphratica] Length = 260 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRA 116 GLSGGWRGFS++H LV+GD LVFQLV P +FKVYI RA Sbjct: 178 GLSGGWRGFSIDHELVDGDALVFQLVSPTRFKVYIARA 215 >XP_010519303.1 PREDICTED: B3 domain-containing protein At3g19184 isoform X2 [Tarenaya hassleriana] Length = 260 Score = 65.1 bits (157), Expect = 2e-10 Identities = 38/77 (49%), Positives = 47/77 (61%), Gaps = 10/77 (12%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFR--------ASG--TSHATKEFTY 152 GLSGGWRGFS+ H LV+GD L+FQLV P KFKVYI R A+G + ++ T Sbjct: 182 GLSGGWRGFSINHGLVDGDALLFQLVAPTKFKVYIIRVYNDDDFCANGGDKENESENGTE 241 Query: 153 PKIKKQFVKKQRRYAGR 203 K K K++RR GR Sbjct: 242 TKELKGTAKRKRRGRGR 258 >XP_006379203.1 hypothetical protein POPTR_0009s10600g [Populus trichocarpa] ERP57000.1 hypothetical protein POPTR_0009s10600g [Populus trichocarpa] Length = 260 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRA 116 GLSGGWRGFS++H LV+GD LVFQLV P +FKVYI RA Sbjct: 178 GLSGGWRGFSIDHELVDGDALVFQLVSPTRFKVYIARA 215 >XP_002313112.2 hypothetical protein POPTR_0009s10590g [Populus trichocarpa] EEE87067.2 hypothetical protein POPTR_0009s10590g [Populus trichocarpa] Length = 270 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRA 116 GLSGGWRGF+++H LV+GD LVFQLV P KFKVYI RA Sbjct: 178 GLSGGWRGFAIDHDLVDGDALVFQLVSPTKFKVYIVRA 215 >XP_006379204.1 hypothetical protein POPTR_0009s10600g [Populus trichocarpa] ERP57001.1 hypothetical protein POPTR_0009s10600g [Populus trichocarpa] Length = 278 Score = 65.1 bits (157), Expect = 2e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 GLSGGWRGFSLEHWLVEGDTLVFQLVDPRKFKVYIFRA 116 GLSGGWRGFS++H LV+GD LVFQLV P +FKVYI RA Sbjct: 178 GLSGGWRGFSIDHELVDGDALVFQLVSPTRFKVYIARA 215