BLASTX nr result
ID: Alisma22_contig00044503
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00044503 (240 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY85053.1 26S proteasome non-ATPase regulatory subunit, partial... 60 1e-08 XP_009419391.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 57 8e-08 XP_020096331.1 26S proteasome non-ATPase regulatory subunit 11 h... 57 1e-07 XP_010932448.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 56 3e-07 XP_008791916.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 56 3e-07 GAU10861.1 hypothetical protein TSUD_424960, partial [Trifolium ... 52 6e-07 XP_010917140.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 55 7e-07 KMZ75348.1 26S proteasome non-ATPase regulatory subunit [Zostera... 54 1e-06 GAU10316.1 hypothetical protein TSUD_424050, partial [Trifolium ... 52 2e-06 XP_002319533.1 19S proteosome subunit 9 family protein [Populus ... 54 2e-06 XP_010108777.1 26S proteasome non-ATPase regulatory subunit 11 [... 54 2e-06 XP_006601039.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 53 3e-06 XP_004987378.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 52 3e-06 XP_018836824.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 53 4e-06 XP_008339853.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 53 4e-06 XP_004963123.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 52 5e-06 AFK38243.1 unknown [Medicago truncatula] 52 7e-06 XP_003588599.1 26S proteasome non-ATPase regulatory subunit-like... 52 7e-06 XP_009420501.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 52 7e-06 XP_009356341.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 52 9e-06 >OAY85053.1 26S proteasome non-ATPase regulatory subunit, partial [Ananas comosus] Length = 287 Score = 59.7 bits (143), Expect = 1e-08 Identities = 31/52 (59%), Positives = 36/52 (69%) Frame = +1 Query: 82 LPRSPPAECQLETAAMSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 L R P + +A TYLPAT DSI QALEAKD SESISIL+ +L NPS+ Sbjct: 34 LSRFPTQVVTMSSAMQPTYLPATTDSIAQALEAKDPSESISILYQVLQNPSS 85 >XP_009419391.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Musa acuminata subsp. malaccensis] Length = 421 Score = 57.4 bits (137), Expect = 8e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +1 Query: 127 MSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 M++YLPAT DSI QALEAKDASESIS+L+ +L NPSA Sbjct: 1 MASYLPATTDSIAQALEAKDASESISMLYRVLENPSA 37 >XP_020096331.1 26S proteasome non-ATPase regulatory subunit 11 homolog [Ananas comosus] XP_020096340.1 26S proteasome non-ATPase regulatory subunit 11 homolog [Ananas comosus] XP_020096347.1 26S proteasome non-ATPase regulatory subunit 11 homolog [Ananas comosus] XP_020096354.1 26S proteasome non-ATPase regulatory subunit 11 homolog [Ananas comosus] Length = 426 Score = 57.0 bits (136), Expect = 1e-07 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = +1 Query: 112 LETAAMSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 + +A TYLPAT DSI QALEAKD SESISIL+ +L NPS+ Sbjct: 1 MSSAMQPTYLPATTDSIAQALEAKDPSESISILYQVLQNPSS 42 >XP_010932448.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Elaeis guineensis] XP_010932449.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Elaeis guineensis] XP_010932450.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Elaeis guineensis] XP_019709030.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Elaeis guineensis] Length = 426 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +1 Query: 112 LETAAMSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 + +A ++YLPAT DSI QALEAKD SESISIL+ +L NPS+ Sbjct: 1 MSSAIQASYLPATTDSIAQALEAKDPSESISILYHVLENPSS 42 >XP_008791916.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Phoenix dactylifera] Length = 426 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = +1 Query: 112 LETAAMSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 + +A ++YLPAT DSI QALEAKD SESISIL+ +L NPS+ Sbjct: 1 MSSAMQTSYLPATTDSIAQALEAKDPSESISILYRVLENPSS 42 >GAU10861.1 hypothetical protein TSUD_424960, partial [Trifolium subterraneum] Length = 88 Score = 52.0 bits (123), Expect = 6e-07 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 127 MSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 MS++LPAT +SI QALEAKD SESISIL+ +L +PS+ Sbjct: 1 MSSFLPATTESIAQALEAKDPSESISILYRVLGDPSS 37 >XP_010917140.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Elaeis guineensis] XP_010917141.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Elaeis guineensis] XP_010917142.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Elaeis guineensis] Length = 426 Score = 54.7 bits (130), Expect = 7e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +1 Query: 112 LETAAMSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 + +A ++YLPAT DSI QALEAKD SESISIL+ +L NP++ Sbjct: 1 MSSAMQASYLPATTDSIAQALEAKDPSESISILYRVLENPAS 42 >KMZ75348.1 26S proteasome non-ATPase regulatory subunit [Zostera marina] Length = 421 Score = 54.3 bits (129), Expect = 1e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +1 Query: 127 MSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 MS+YLPAT DSI QALEAKDA ESISIL+ ++ NP++ Sbjct: 1 MSSYLPATTDSIAQALEAKDALESISILYRVIENPAS 37 >GAU10316.1 hypothetical protein TSUD_424050, partial [Trifolium subterraneum] Length = 135 Score = 52.0 bits (123), Expect = 2e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 127 MSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 MS++LPAT +SI QALEAKD SESISIL+ +L +PS+ Sbjct: 1 MSSFLPATTESIAQALEAKDPSESISILYRVLGDPSS 37 >XP_002319533.1 19S proteosome subunit 9 family protein [Populus trichocarpa] EEE95456.1 19S proteosome subunit 9 family protein [Populus trichocarpa] Length = 422 Score = 53.5 bits (127), Expect = 2e-06 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = +1 Query: 127 MST-YLPATADSIDQALEAKDASESISILHSILANPSA 237 MST YLPAT DSIDQALEAK+ SE ISIL+ IL NPS+ Sbjct: 1 MSTPYLPATTDSIDQALEAKNPSEGISILYRILENPSS 38 >XP_010108777.1 26S proteasome non-ATPase regulatory subunit 11 [Morus notabilis] EXC20292.1 26S proteasome non-ATPase regulatory subunit 11 [Morus notabilis] Length = 425 Score = 53.5 bits (127), Expect = 2e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 121 AAMSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 A+ S+YLPAT DSI QALEAK SESISIL+ +L NPS+ Sbjct: 2 ASSSSYLPATTDSIAQALEAKTPSESISILYRVLENPSS 40 >XP_006601039.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog isoform X1 [Glycine max] Length = 460 Score = 53.1 bits (126), Expect = 3e-06 Identities = 25/39 (64%), Positives = 35/39 (89%) Frame = +1 Query: 121 AAMSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 AAMS++LPA+A+S+D A+EAKD SESISIL+ +L +PS+ Sbjct: 38 AAMSSFLPASAESLDLAVEAKDPSESISILYQVLDDPSS 76 >XP_004987378.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog, partial [Setaria italica] Length = 205 Score = 52.4 bits (124), Expect = 3e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 112 LETAAMSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 + T+ S YLPAT +SI +A EAKDASESISIL+ +L +PS+ Sbjct: 1 MSTSVQSPYLPATTESISKAQEAKDASESISILYRVLEDPSS 42 >XP_018836824.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Juglans regia] Length = 422 Score = 52.8 bits (125), Expect = 4e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 130 STYLPATADSIDQALEAKDASESISILHSILANPSA 237 S+YLPAT DSI QALEAK+A+E+ISIL+ IL NPS+ Sbjct: 3 SSYLPATTDSIAQALEAKNAAEAISILYRILENPSS 38 >XP_008339853.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Malus domestica] Length = 422 Score = 52.8 bits (125), Expect = 4e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 130 STYLPATADSIDQALEAKDASESISILHSILANPSA 237 S+YLPAT DSI QALEAK SESISIL+ +L NPSA Sbjct: 3 SSYLPATTDSIAQALEAKAPSESISILYRVLENPSA 38 >XP_004963123.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Setaria italica] XP_004963124.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Setaria italica] KQL17140.1 hypothetical protein SETIT_022130mg [Setaria italica] KQL17141.1 hypothetical protein SETIT_022130mg [Setaria italica] Length = 426 Score = 52.4 bits (124), Expect = 5e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 112 LETAAMSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 + T+ S YLPAT +SI +A EAKDASESISIL+ +L +PS+ Sbjct: 1 MSTSVQSPYLPATTESISKAQEAKDASESISILYRVLEDPSS 42 >AFK38243.1 unknown [Medicago truncatula] Length = 421 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 127 MSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 MS++LPAT +SI QALEAKD SESISIL+ +L +PS+ Sbjct: 1 MSSFLPATTESIAQALEAKDPSESISILYRVLGDPSS 37 >XP_003588599.1 26S proteasome non-ATPase regulatory subunit-like protein [Medicago truncatula] AES58850.1 26S proteasome non-ATPase regulatory subunit-like protein [Medicago truncatula] Length = 421 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = +1 Query: 127 MSTYLPATADSIDQALEAKDASESISILHSILANPSA 237 MS++LPAT +SI QALEAKD SESISIL+ +L +PS+ Sbjct: 1 MSSFLPATTESIAQALEAKDPSESISILYRVLGDPSS 37 >XP_009420501.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Musa acuminata subsp. malaccensis] XP_009420502.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Musa acuminata subsp. malaccensis] XP_009420503.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Musa acuminata subsp. malaccensis] Length = 422 Score = 52.0 bits (123), Expect = 7e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +1 Query: 130 STYLPATADSIDQALEAKDASESISILHSILANPSA 237 S YLPAT DSI QALEAKD +ESIS+L+ +L NPS+ Sbjct: 3 SAYLPATTDSIAQALEAKDHAESISLLYRVLENPSS 38 >XP_009356341.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 11 homolog [Pyrus x bretschneideri] Length = 422 Score = 51.6 bits (122), Expect = 9e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +1 Query: 130 STYLPATADSIDQALEAKDASESISILHSILANPSA 237 S+YLPAT DSI QA EAK SESISIL+ IL NPSA Sbjct: 3 SSYLPATTDSIAQAAEAKTPSESISILYRILENPSA 38