BLASTX nr result
ID: Alisma22_contig00044099
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00044099 (473 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAF79607.1 F5M15.12 [Arabidopsis thaliana] 55 9e-06 AAF80642.1 F2D10.4 [Arabidopsis thaliana] 55 9e-06 >AAF79607.1 F5M15.12 [Arabidopsis thaliana] Length = 579 Score = 54.7 bits (130), Expect = 9e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 114 IGLLSYFLYQVAVLAPNVPAMYELHFGAAMAGTILCTL 1 + LL + + +V+VLAPNVPAM ELHFG MAG +LCTL Sbjct: 82 LSLLRFLILKVSVLAPNVPAMVELHFGVPMAGALLCTL 119 >AAF80642.1 F2D10.4 [Arabidopsis thaliana] Length = 581 Score = 54.7 bits (130), Expect = 9e-06 Identities = 24/38 (63%), Positives = 30/38 (78%) Frame = -3 Query: 114 IGLLSYFLYQVAVLAPNVPAMYELHFGAAMAGTILCTL 1 + LL + + +V+VLAPNVPAM ELHFG MAG +LCTL Sbjct: 84 LSLLRFLILKVSVLAPNVPAMVELHFGVPMAGALLCTL 121