BLASTX nr result
ID: Alisma22_contig00043968
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00043968 (340 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABI34354.1 Retrotransposon gag protein [Solanum demissum] 56 7e-07 AAT38744.1 Putative gag-pol polyprotein, identical [Solanum demi... 53 9e-06 AAT38724.1 Putative retrotransposon protein, identical [Solanum ... 53 9e-06 >ABI34354.1 Retrotransposon gag protein [Solanum demissum] Length = 4543 Score = 56.2 bits (134), Expect = 7e-07 Identities = 23/42 (54%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +3 Query: 48 RGENRFQKCRTCGRSHPGKCR-FEKVCYRCQQEGHFIANCPQ 170 RG + F C CGR HPGKCR + C+RC QEGHF+ CP+ Sbjct: 272 RGGSSFPACAKCGRVHPGKCRQGQTCCFRCGQEGHFMKECPK 313 Score = 56.2 bits (134), Expect = 7e-07 Identities = 23/42 (54%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +3 Query: 48 RGENRFQKCRTCGRSHPGKCR-FEKVCYRCQQEGHFIANCPQ 170 RG + F C CGR HPGKCR + C+RC QEGHF+ CP+ Sbjct: 1782 RGGSSFPACAKCGRVHPGKCRQGQTCCFRCGQEGHFMKECPK 1823 Score = 56.2 bits (134), Expect = 7e-07 Identities = 23/42 (54%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +3 Query: 48 RGENRFQKCRTCGRSHPGKCR-FEKVCYRCQQEGHFIANCPQ 170 RG + F C CGR HPGKCR + C+RC QEGHF+ CP+ Sbjct: 3292 RGGSSFPACAKCGRVHPGKCRQGQTCCFRCGQEGHFMKECPK 3333 >AAT38744.1 Putative gag-pol polyprotein, identical [Solanum demissum] Length = 1515 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = +3 Query: 63 FQKCRTCGRSHPGKCRFEKV-CYRCQQEGHFIANCPQ 170 F C CGR+HPGKCR + C++C QEGHF+ CP+ Sbjct: 373 FPACARCGRTHPGKCRDGQTGCFKCGQEGHFVKECPK 409 >AAT38724.1 Putative retrotransposon protein, identical [Solanum demissum] Length = 1602 Score = 53.1 bits (126), Expect = 9e-06 Identities = 20/37 (54%), Positives = 26/37 (70%), Gaps = 1/37 (2%) Frame = +3 Query: 63 FQKCRTCGRSHPGKCRFEKV-CYRCQQEGHFIANCPQ 170 F C CGR+HPGKCR + C++C QEGHF+ CP+ Sbjct: 379 FPACARCGRTHPGKCRDGQTGCFKCGQEGHFVKECPK 415