BLASTX nr result
ID: Alisma22_contig00043892
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00043892 (221 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006590548.1 PREDICTED: uncharacterized protein LOC102663387 [... 63 6e-10 AFB32342.1 hypothetical protein 0_12190_01, partial [Abies alba]... 59 3e-09 XP_003516674.1 PREDICTED: uncharacterized protein LOC100802491 [... 61 3e-09 XP_015964384.1 PREDICTED: uncharacterized protein LOC107488195 [... 61 4e-09 KHN34971.1 hypothetical protein glysoja_004737 [Glycine soja] 60 5e-09 KDP25589.1 hypothetical protein JCGZ_20745 [Jatropha curcas] 60 5e-09 XP_012087087.1 PREDICTED: uncharacterized protein LOC105645948 [... 60 5e-09 XP_015896562.1 PREDICTED: uncharacterized protein LOC107430252 [... 60 5e-09 XP_016202034.1 PREDICTED: uncharacterized protein LOC107643011 [... 60 7e-09 AEW08015.1 hypothetical protein 0_17009_02, partial [Pinus radia... 57 9e-09 AEW07817.1 hypothetical protein 0_12190_01, partial [Pinus radia... 58 1e-08 XP_019420359.1 PREDICTED: uncharacterized protein LOC109330578 [... 60 1e-08 XP_006368715.1 hypothetical protein POPTR_0001s08040g [Populus t... 59 1e-08 XP_019081802.1 PREDICTED: uncharacterized protein LOC100266895 i... 59 1e-08 CAN75358.1 hypothetical protein VITISV_034344 [Vitis vinifera] 59 1e-08 XP_011029100.1 PREDICTED: uncharacterized protein LOC105128937 i... 59 1e-08 XP_010277356.1 PREDICTED: uncharacterized protein LOC104611827 [... 59 1e-08 XP_011029099.1 PREDICTED: uncharacterized protein LOC105128937 i... 59 1e-08 XP_017639229.1 PREDICTED: uncharacterized protein LOC108480670 [... 59 1e-08 XP_016755582.1 PREDICTED: uncharacterized protein LOC107963662 [... 59 1e-08 >XP_006590548.1 PREDICTED: uncharacterized protein LOC102663387 [Glycine max] KRH28018.1 hypothetical protein GLYMA_11G029400 [Glycine max] Length = 731 Score = 63.2 bits (152), Expect = 6e-10 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+ D++RD FW DL AVHSL+K V E++K++E ERP VGQCL Sbjct: 457 EVGDMIRDVGFWNDLEAVHSLVKLVKEMVKEIETERPLVGQCL 499 >AFB32342.1 hypothetical protein 0_12190_01, partial [Abies alba] AFB32343.1 hypothetical protein 0_12190_01, partial [Abies alba] AFB32344.1 hypothetical protein 0_12190_01, partial [Abies alba] AFB32345.1 hypothetical protein 0_12190_01, partial [Abies alba] AFB32346.1 hypothetical protein 0_12190_01, partial [Abies alba] AFB32347.1 hypothetical protein 0_12190_01, partial [Abies alba] AFB32348.1 hypothetical protein 0_12190_01, partial [Abies alba] AFB32349.1 hypothetical protein 0_12190_01, partial [Abies alba] AFB32350.1 hypothetical protein 0_12190_01, partial [Abies alba] AFB32351.1 hypothetical protein 0_12190_01, partial [Abies alba] AFB32352.1 hypothetical protein 0_12190_01, partial [Abies alba] Length = 155 Score = 59.3 bits (142), Expect = 3e-09 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -1 Query: 137 GAEIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 G EIAD+++D FW DL+AV SL+K + +++D+E ERP VGQCL Sbjct: 19 GREIADMIQDMRFWNDLDAVLSLVKLIRVMVQDIEGERPLVGQCL 63 >XP_003516674.1 PREDICTED: uncharacterized protein LOC100802491 [Glycine max] KRH77421.1 hypothetical protein GLYMA_01G212400 [Glycine max] Length = 750 Score = 61.2 bits (147), Expect = 3e-09 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+ D++RD FW DL AVHSL+K V E+++++E ERP VGQCL Sbjct: 476 EVGDMIRDVGFWNDLEAVHSLVKLVEEMVQEIETERPLVGQCL 518 >XP_015964384.1 PREDICTED: uncharacterized protein LOC107488195 [Arachis duranensis] Length = 777 Score = 60.8 bits (146), Expect = 4e-09 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+ DI+ D FW DLNAVHSL+K V +L +++E ERP VGQCL Sbjct: 501 EVGDIIGDVGFWNDLNAVHSLVKLVRDLAQEIESERPLVGQCL 543 >KHN34971.1 hypothetical protein glysoja_004737 [Glycine soja] Length = 682 Score = 60.5 bits (145), Expect = 5e-09 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+ ++RD FW DL AVHSL+K V E++K++E ERP VGQCL Sbjct: 408 EVGGMIRDVGFWNDLEAVHSLVKLVKEMVKEIETERPLVGQCL 450 >KDP25589.1 hypothetical protein JCGZ_20745 [Jatropha curcas] Length = 780 Score = 60.5 bits (145), Expect = 5e-09 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+AD++RD FW +L AVHSL+K + E+ +++E ERP VGQCL Sbjct: 508 EVADMIRDVSFWNELEAVHSLVKLIKEMAQEIETERPLVGQCL 550 >XP_012087087.1 PREDICTED: uncharacterized protein LOC105645948 [Jatropha curcas] Length = 818 Score = 60.5 bits (145), Expect = 5e-09 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+AD++RD FW +L AVHSL+K + E+ +++E ERP VGQCL Sbjct: 546 EVADMIRDVSFWNELEAVHSLVKLIKEMAQEIETERPLVGQCL 588 >XP_015896562.1 PREDICTED: uncharacterized protein LOC107430252 [Ziziphus jujuba] Length = 877 Score = 60.5 bits (145), Expect = 5e-09 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 EIAD++ D FW +L AVHSL+K + E+ KD+E ERP VGQCL Sbjct: 603 EIADMIGDVGFWNELEAVHSLVKLIKEIAKDIETERPLVGQCL 645 >XP_016202034.1 PREDICTED: uncharacterized protein LOC107643011 [Arachis ipaensis] Length = 781 Score = 60.1 bits (144), Expect = 7e-09 Identities = 25/43 (58%), Positives = 33/43 (76%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+ DI+ D FW DLNAVHSL+K V ++ +++E ERP VGQCL Sbjct: 501 EVGDIIGDVGFWNDLNAVHSLVKLVRDIAQEIESERPLVGQCL 543 >AEW08015.1 hypothetical protein 0_17009_02, partial [Pinus radiata] AFG63133.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63134.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63135.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63136.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63138.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63139.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63140.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63141.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63142.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63143.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63144.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63145.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63146.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63147.1 hypothetical protein 0_17009_02, partial [Pinus taeda] AFG63148.1 hypothetical protein 0_17009_02, partial [Pinus taeda] Length = 134 Score = 57.4 bits (137), Expect = 9e-09 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -1 Query: 137 GAEIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 G E+AD++RD FW +L+AV SL+K V +I+++E ERP VGQCL Sbjct: 14 GREVADMIRDMRFWNELDAVLSLVKLVKMMIQEIEVERPLVGQCL 58 >AEW07817.1 hypothetical protein 0_12190_01, partial [Pinus radiata] AFG68080.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68081.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68082.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68083.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68084.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68085.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68086.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68087.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68088.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68089.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68090.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68091.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68092.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68093.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68094.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68095.1 hypothetical protein 0_12190_01, partial [Pinus taeda] AFG68096.1 hypothetical protein 0_12190_01, partial [Pinus taeda] Length = 155 Score = 57.8 bits (138), Expect = 1e-08 Identities = 25/45 (55%), Positives = 35/45 (77%) Frame = -1 Query: 137 GAEIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 G E+AD+++D FW DL+AV SL+K + L++DVE +RP VGQCL Sbjct: 19 GRELADMIQDIRFWNDLDAVLSLVKLIRMLVQDVEADRPLVGQCL 63 >XP_019420359.1 PREDICTED: uncharacterized protein LOC109330578 [Lupinus angustifolius] Length = 746 Score = 59.7 bits (143), Expect = 1e-08 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+ DI+RD FW DL AVH+L+K V +++ ++E ERP VGQCL Sbjct: 472 EVGDIIRDVGFWNDLEAVHTLVKLVKDMVHEIETERPLVGQCL 514 >XP_006368715.1 hypothetical protein POPTR_0001s08040g [Populus trichocarpa] ERP65284.1 hypothetical protein POPTR_0001s08040g [Populus trichocarpa] Length = 760 Score = 59.3 bits (142), Expect = 1e-08 Identities = 24/43 (55%), Positives = 35/43 (81%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+A+++RD FW DL+AVHSL+K + E+ +++E ERP VGQCL Sbjct: 488 EVAEMIRDVGFWNDLDAVHSLVKLIKEMAQEIEIERPLVGQCL 530 >XP_019081802.1 PREDICTED: uncharacterized protein LOC100266895 isoform X2 [Vitis vinifera] Length = 762 Score = 59.3 bits (142), Expect = 1e-08 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 5/76 (6%) Frame = -1 Query: 215 AMLEDVLVNSKXXXXXXXXXXXXXXD-----GAEIADIVRDSIFWEDLNAVHSLIKAVLE 51 AMLED++ N++ E+AD+++D FW +L+AVHSL+K + E Sbjct: 455 AMLEDIMSNAQVLQLVVMDESYKVICVEDPAAREVADMIQDVRFWNELDAVHSLVKLIRE 514 Query: 50 LIKDVEDERPFVGQCL 3 + +++E ERP VGQCL Sbjct: 515 MAQEIEVERPLVGQCL 530 >CAN75358.1 hypothetical protein VITISV_034344 [Vitis vinifera] Length = 762 Score = 59.3 bits (142), Expect = 1e-08 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 5/76 (6%) Frame = -1 Query: 215 AMLEDVLVNSKXXXXXXXXXXXXXXD-----GAEIADIVRDSIFWEDLNAVHSLIKAVLE 51 AMLED++ N++ E+AD+++D FW +L+AVHSL+K + E Sbjct: 455 AMLEDIMSNAQVLQLVVMDESYKVICVEDPAAREVADMIQDVRFWNELDAVHSLVKLIRE 514 Query: 50 LIKDVEDERPFVGQCL 3 + +++E ERP VGQCL Sbjct: 515 MAQEIEVERPLVGQCL 530 >XP_011029100.1 PREDICTED: uncharacterized protein LOC105128937 isoform X3 [Populus euphratica] Length = 771 Score = 59.3 bits (142), Expect = 1e-08 Identities = 24/43 (55%), Positives = 35/43 (81%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+A+++RD FW DL+AVHSL+K + E+ +++E ERP VGQCL Sbjct: 509 EVAEMIRDVGFWNDLDAVHSLVKLIKEMAQEIEIERPLVGQCL 551 >XP_010277356.1 PREDICTED: uncharacterized protein LOC104611827 [Nelumbo nucifera] Length = 775 Score = 59.3 bits (142), Expect = 1e-08 Identities = 30/76 (39%), Positives = 43/76 (56%), Gaps = 5/76 (6%) Frame = -1 Query: 215 AMLEDVLVNSKXXXXXXXXXXXXXXD-----GAEIADIVRDSIFWEDLNAVHSLIKAVLE 51 AMLED++ +++ E+AD++RD FW +L AVHSL+K V Sbjct: 468 AMLEDIMASARALQLVVLDESYKVVCVEDPVAREVADMIRDMGFWSELEAVHSLVKLVKG 527 Query: 50 LIKDVEDERPFVGQCL 3 + +D+E ERP VGQCL Sbjct: 528 MAQDIEAERPLVGQCL 543 >XP_011029099.1 PREDICTED: uncharacterized protein LOC105128937 isoform X2 [Populus euphratica] Length = 781 Score = 59.3 bits (142), Expect = 1e-08 Identities = 24/43 (55%), Positives = 35/43 (81%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+A+++RD FW DL+AVHSL+K + E+ +++E ERP VGQCL Sbjct: 509 EVAEMIRDVGFWNDLDAVHSLVKLIKEMAQEIEIERPLVGQCL 551 >XP_017639229.1 PREDICTED: uncharacterized protein LOC108480670 [Gossypium arboreum] Length = 782 Score = 59.3 bits (142), Expect = 1e-08 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+A+++RD FW DL AVHSL+K + E+ ++E ERP VGQCL Sbjct: 508 EVAEMIRDMGFWNDLEAVHSLVKLIKEMAHEIETERPLVGQCL 550 >XP_016755582.1 PREDICTED: uncharacterized protein LOC107963662 [Gossypium hirsutum] Length = 782 Score = 59.3 bits (142), Expect = 1e-08 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = -1 Query: 131 EIADIVRDSIFWEDLNAVHSLIKAVLELIKDVEDERPFVGQCL 3 E+A+++RD FW DL AVHSL+K + E+ ++E ERP VGQCL Sbjct: 508 EVAEMIRDMGFWNDLEAVHSLVKLIKEMAHEIETERPLVGQCL 550