BLASTX nr result
ID: Alisma22_contig00043766
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00043766 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_006665838.1 hypothetical chloroplast RF19 (chloroplast) [Elod... 69 6e-11 YP_009248150.1 hypothetical chloroplast RF19 (plastid) [Metroxyl... 61 2e-08 AKF01662.1 hypothetical chloroplast RF19 (chloroplast) [Heterosp... 61 3e-08 AGE93342.1 hypothetical chloroplast RF19 (plastid) [Chamaedorea ... 60 5e-08 YP_009335476.1 hypothetical chloroplast RF19 (chloroplast) [Ozir... 60 7e-08 YP_009248490.1 hypothetical chloroplast RF19 (plastid) [Eugeisso... 60 7e-08 YP_009247124.1 hypothetical chloroplast RF19 (chloroplast) [Maur... 60 7e-08 YP_007475933.1 hypothetical chloroplast RF19 [Calamus caryotoide... 60 7e-08 AKF01427.1 hypothetical chloroplast RF19, partial (chloroplast) ... 59 9e-08 YP_009247381.1 hypothetical chloroplast RF19 (plastid) [Veitchia... 59 1e-07 AKF00897.1 hypothetical chloroplast RF19 (chloroplast) [Veitchia... 59 1e-07 YP_007475847.1 hypothetical chloroplast RF19 [Pseudophoenix vini... 59 1e-07 YP_009247978.1 hypothetical chloroplast RF19 (plastid) [Phytelep... 59 1e-07 YP_009249263.1 hypothetical chloroplast RF19 (plastid) [Areca ve... 59 1e-07 AEX94027.1 hypothetical chloroplast RF19 (chloroplast) [Dasyliri... 59 1e-07 YP_009335390.1 hypothetical chloroplast RF19 (chloroplast) [Noli... 59 1e-07 YP_009247892.1 hypothetical chloroplast RF19 (plastid) [Pigafett... 59 1e-07 YP_009247719.1 hypothetical chloroplast RF19 (plastid) [Salacca ... 59 2e-07 YP_001595554.1 Ycf1 [Lemna minor] YP_001595567.1 Ycf1 [Lemna min... 59 2e-07 AOX14576.1 TIC214, partial (plastid) [Tillandsia recurvata] 58 2e-07 >YP_006665838.1 hypothetical chloroplast RF19 (chloroplast) [Elodea canadensis] AEY84711.1 hypothetical chloroplast RF19 (chloroplast) [Elodea canadensis] Length = 1771 Score = 68.6 bits (166), Expect = 6e-11 Identities = 33/49 (67%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRIS-KKPQFFPEFGL 144 ILS IHQ+ KPS NQK FFDWMGMN+E+LY IS +KP+FFPEFG+ Sbjct: 1386 ILSLTIHQEIKPSNSNQKRNFFDWMGMNKEKLYGDISNRKPEFFPEFGI 1434 >YP_009248150.1 hypothetical chloroplast RF19 (plastid) [Metroxylon warburgii] AMW66116.1 hypothetical chloroplast RF19 (plastid) [Metroxylon warburgii] Length = 1887 Score = 61.2 bits (147), Expect = 2e-08 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I SP IHQ KPS NQKS FFDWMGMN+E++Y IS +P FFPEF Sbjct: 1471 IFSPTIHQGIKPS--NQKSVFFDWMGMNQEKVYRTISNLEPWFFPEF 1515 >AKF01662.1 hypothetical chloroplast RF19 (chloroplast) [Heterospathe cagayanensis] Length = 1822 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/47 (65%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I S IHQ KPS NQKS FFDWMGMN+E++YH IS +PQ FPEF Sbjct: 1446 IFSLTIHQGIKPS--NQKSVFFDWMGMNQEKVYHTISNLEPQLFPEF 1490 >AGE93342.1 hypothetical chloroplast RF19 (plastid) [Chamaedorea seifrizii] Length = 1755 Score = 60.1 bits (144), Expect = 5e-08 Identities = 30/47 (63%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I S IH++ KPS NQKS FFDWMGMN+E+LY IS +P+FFPEF Sbjct: 1397 IFSKTIHKEIKPS--NQKSVFFDWMGMNQEKLYRTISNIEPRFFPEF 1441 >YP_009335476.1 hypothetical chloroplast RF19 (chloroplast) [Oziroe biflora] AEX94021.1 hypothetical chloroplast RF19 (chloroplast) [Oziroe biflora] APO12534.1 hypothetical chloroplast RF19 (chloroplast) [Oziroe biflora] Length = 1801 Score = 59.7 bits (143), Expect = 7e-08 Identities = 31/51 (60%), Positives = 34/51 (66%), Gaps = 4/51 (7%) Frame = +1 Query: 4 LSPRIHQKKKPSKM---NQKSFFFDWMGMNEERLYHRISK-KPQFFPEFGL 144 + RIHQK PS NQK FFDWMGMN+ERLY IS +P FFPEF L Sbjct: 1406 IDTRIHQKINPSNQKPSNQKKHFFDWMGMNQERLYRTISNLEPWFFPEFVL 1456 >YP_009248490.1 hypothetical chloroplast RF19 (plastid) [Eugeissona tristis] AMW66542.1 hypothetical chloroplast RF19 (plastid) [Eugeissona tristis] Length = 1846 Score = 59.7 bits (143), Expect = 7e-08 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I SP HQ KPS NQKS FFDWMGMN+E++Y IS +P FFPEF Sbjct: 1437 IFSPTTHQGIKPS--NQKSVFFDWMGMNQEKIYRTISNLEPWFFPEF 1481 >YP_009247124.1 hypothetical chloroplast RF19 (chloroplast) [Mauritia flexuosa] AMW65090.1 hypothetical chloroplast RF19 (chloroplast) [Mauritia flexuosa] Length = 1866 Score = 59.7 bits (143), Expect = 7e-08 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I SP IHQ KPS NQK FFDWMGMN+E++Y IS +P FFPEF Sbjct: 1457 IFSPTIHQGIKPS--NQKKHFFDWMGMNQEKVYRTISNLEPWFFPEF 1501 >YP_007475933.1 hypothetical chloroplast RF19 [Calamus caryotoides] AGE92998.1 hypothetical chloroplast RF19 (plastid) [Calamus caryotoides] Length = 1879 Score = 59.7 bits (143), Expect = 7e-08 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I SP IHQ KPS NQK FFDWMGMN+E++Y IS +P FFPEF Sbjct: 1463 IFSPTIHQGIKPS--NQKKHFFDWMGMNQEKVYRTISNLEPWFFPEF 1507 >AKF01427.1 hypothetical chloroplast RF19, partial (chloroplast) [Drymophloeus litigiosus] Length = 1077 Score = 59.3 bits (142), Expect = 9e-08 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I S IHQ KPS NQK FFDWMGMN+E++YH IS +PQ FPEF Sbjct: 690 IFSLTIHQGIKPS--NQKKHFFDWMGMNQEKVYHTISNLEPQLFPEF 734 >YP_009247381.1 hypothetical chloroplast RF19 (plastid) [Veitchia arecina] AMW65347.1 hypothetical chloroplast RF19 (plastid) [Veitchia arecina] Length = 1825 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I S IHQ KPS NQK FFDWMGMN+E++YH IS +PQ FPEF Sbjct: 1438 IFSLTIHQGIKPS--NQKKHFFDWMGMNQEKVYHTISNLEPQLFPEF 1482 >AKF00897.1 hypothetical chloroplast RF19 (chloroplast) [Veitchia spiralis] Length = 1826 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I S IHQ KPS NQK FFDWMGMN+E++YH IS +PQ FPEF Sbjct: 1439 IFSLTIHQGIKPS--NQKKHFFDWMGMNQEKVYHTISNLEPQLFPEF 1483 >YP_007475847.1 hypothetical chloroplast RF19 [Pseudophoenix vinifera] AGE92912.1 hypothetical chloroplast RF19 (plastid) [Pseudophoenix vinifera] Length = 1866 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I S IHQ KPS NQKS FFDWMGMN+E+ Y IS +P+FFPEF Sbjct: 1459 IFSKTIHQGIKPS--NQKSIFFDWMGMNQEKFYRTISNLEPRFFPEF 1503 >YP_009247978.1 hypothetical chloroplast RF19 (plastid) [Phytelephas aequatorialis] AMW65944.1 hypothetical chloroplast RF19 (plastid) [Phytelephas aequatorialis] Length = 1871 Score = 59.3 bits (142), Expect = 1e-07 Identities = 30/47 (63%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I S IHQ KPS NQKS FFDWMGMN+E++Y IS +P+FFPEF Sbjct: 1464 IFSKTIHQGIKPS--NQKSVFFDWMGMNQEKVYRTISNLEPRFFPEF 1508 >YP_009249263.1 hypothetical chloroplast RF19 (plastid) [Areca vestiaria] AMW67316.1 hypothetical chloroplast RF19 (plastid) [Areca vestiaria] Length = 1788 Score = 58.9 bits (141), Expect = 1e-07 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 3/49 (6%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK---KPQFFPEF 138 I S IHQ KPS NQKS FFDWMGMN+E++Y ISK +PQ FPEF Sbjct: 1398 IFSLTIHQGIKPS--NQKSVFFDWMGMNQEKVYRTISKSNLEPQLFPEF 1444 >AEX94027.1 hypothetical chloroplast RF19 (chloroplast) [Dasylirion wheeleri] Length = 1801 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/44 (65%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = +1 Query: 16 IHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEFGL 144 IH K PS NQK +FFDW+GMN+ERLYH IS +P FFPEF L Sbjct: 1401 IHHKINPS--NQKKYFFDWIGMNQERLYHTISNLEPWFFPEFVL 1442 >YP_009335390.1 hypothetical chloroplast RF19 (chloroplast) [Nolina atopocarpa] APO12448.1 hypothetical chloroplast RF19 (chloroplast) [Nolina atopocarpa] Length = 1813 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/44 (65%), Positives = 33/44 (75%), Gaps = 1/44 (2%) Frame = +1 Query: 16 IHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEFGL 144 IH K PS NQK +FFDW+GMN+ERLYH IS +P FFPEF L Sbjct: 1413 IHHKINPS--NQKKYFFDWIGMNQERLYHTISNLEPWFFPEFVL 1454 >YP_009247892.1 hypothetical chloroplast RF19 (plastid) [Pigafetta elata] AMW65858.1 hypothetical chloroplast RF19 (plastid) [Pigafetta elata] Length = 1885 Score = 58.9 bits (141), Expect = 1e-07 Identities = 30/47 (63%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I SP IHQ KPS NQK FFDWMGMN+E++Y IS +P FFPEF Sbjct: 1471 IFSPTIHQGIKPS--NQKKNFFDWMGMNQEKVYRTISNLEPWFFPEF 1515 >YP_009247719.1 hypothetical chloroplast RF19 (plastid) [Salacca ramosiana] AMW65685.1 hypothetical chloroplast RF19 (plastid) [Salacca ramosiana] Length = 1854 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/47 (63%), Positives = 35/47 (74%), Gaps = 1/47 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEF 138 I SP IHQ KPS NQKS FFDWMGMN+E+++ IS +P FFPEF Sbjct: 1447 IFSPTIHQGIKPS--NQKSVFFDWMGMNQEKVFCTISNLEPWFFPEF 1491 >YP_001595554.1 Ycf1 [Lemna minor] YP_001595567.1 Ycf1 [Lemna minor] A9L9E2.1 RecName: Full=Protein TIC 214; AltName: Full=Translocon at the inner envelope membrane of chloroplasts 214; Short=AtTIC214 ABD48541.1 Ycf1 (chloroplast) [Lemna minor] ABD48554.1 Ycf1 (chloroplast) [Lemna minor] Length = 1911 Score = 58.5 bits (140), Expect = 2e-07 Identities = 28/44 (63%), Positives = 32/44 (72%), Gaps = 1/44 (2%) Frame = +1 Query: 16 IHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEFGL 144 IHQK KPS N++ FDWMGMN+ERLY IS + FFPEFGL Sbjct: 1501 IHQKTKPSTSNKRKKLFDWMGMNKERLYRPISNLESWFFPEFGL 1544 >AOX14576.1 TIC214, partial (plastid) [Tillandsia recurvata] Length = 1472 Score = 58.2 bits (139), Expect = 2e-07 Identities = 31/49 (63%), Positives = 35/49 (71%), Gaps = 1/49 (2%) Frame = +1 Query: 1 ILSPRIHQKKKPSKMNQKSFFFDWMGMNEERLYHRISK-KPQFFPEFGL 144 I S IHQ+ PS NQKS FF+WMGMN+ER+YH IS K FFPEF L Sbjct: 1087 IFSLMIHQEINPS--NQKSIFFNWMGMNQERVYHTISNLKSWFFPEFVL 1133