BLASTX nr result
ID: Alisma22_contig00043535
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Alisma22_contig00043535 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EMS53256.1 hypothetical protein TRIUR3_17095 [Triticum urartu] 56 6e-07 ONK66735.1 uncharacterized protein A4U43_C06F11410 [Asparagus of... 53 1e-05 >EMS53256.1 hypothetical protein TRIUR3_17095 [Triticum urartu] Length = 281 Score = 55.8 bits (133), Expect = 6e-07 Identities = 31/95 (32%), Positives = 53/95 (55%) Frame = +1 Query: 1 LFLGRNTSLCFSLDVLPAGFRKNCIYFTDETIYYLYPPRTPNIEDFLCRDSGIYDYENGT 180 LFLG N+S+CF+ P + NC+Y TD+++ Y+ N+ R++G++D EN + Sbjct: 202 LFLGYNSSMCFATKDFPT-LKPNCVYITDDSVEYV------NMCKHNWRETGVWDIENKS 254 Query: 181 IESFDLQGSPVWMPSVWINLSPPW*RSIWIYMSTF 285 +++FD V + + W+N W +WI S F Sbjct: 255 LQTFD----SVLLTNSWMN----WPSPVWITPSLF 281 >ONK66735.1 uncharacterized protein A4U43_C06F11410 [Asparagus officinalis] Length = 495 Score = 52.8 bits (125), Expect = 1e-05 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 4/86 (4%) Frame = +1 Query: 1 LFLGRNTSLCFSLDVLPAGFRKNCIYFTDETIYYLYPPRTPNIEDF----LCRDSGIYDY 168 LFLG+N SLC G + NCIYFT++ +Y +ED +C D GIYD+ Sbjct: 398 LFLGKNNSLCVRASEYQ-GCKPNCIYFTEQEMYGHTSIARGFLEDVEVDSIC-DMGIYDF 455 Query: 169 ENGTIESFDLQGSPVWMPSVWINLSP 246 E + + F ++P +WI+L P Sbjct: 456 EEESFQDFSELKLRYFVPPIWISLDP 481